BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_A02_e393_02.seq (1501 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 43 2e-05 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 43 2e-05 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 40 2e-04 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 40 2e-04 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 40 2e-04 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 40 2e-04 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 40 2e-04 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 40 2e-04 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 40 2e-04 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 40 2e-04 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 27 1.4 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 27 1.4 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 3.2 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 25 4.3 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 7.5 AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase... 24 9.9 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 24 9.9 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 43.2 bits (97), Expect = 2e-05 Identities = 23/58 (39%), Positives = 31/58 (53%) Frame = +2 Query: 632 EANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 EA RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 1 EAETRFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 54 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 43.2 bits (97), Expect = 2e-05 Identities = 23/58 (39%), Positives = 31/58 (53%) Frame = +2 Query: 632 EANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 EA RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 1 EAETRFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 54 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 52 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 39.9 bits (89), Expect = 2e-04 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 644 RFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGYANYPFTF 805 RF EI ++YE+LSD +RR +DQY G+ N N +Y Y + TF Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY---GITNEDAVLDHNRPEYN-NYGRFKDTF 51 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 27.1 bits (57), Expect = 1.4 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = +2 Query: 608 DKNPDNADEANRRFKEISEAYEVLSDERKRRVYDQYGKEGLNNSRGRRSANDEDYEYGY- 784 +KNP++ E+N +S + ++ + R + +EG+ + +R+ D + G Sbjct: 89 NKNPNSKSESNNLSLSLSLVDMIPEEKLRGRHSSESDREGMGHDSHKRTHRLSDSDGGST 148 Query: 785 --ANYPFTFRDPEEVFREFFGGSPF 853 NY F + ++ +E F S F Sbjct: 149 EGCNYDL-FAEQCDILQEMFPDSSF 172 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 27.1 bits (57), Expect = 1.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 926 CSGGDFGVRSCGGD 885 C+GG FG+ SC GD Sbjct: 303 CAGGVFGIDSCSGD 316 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.8 bits (54), Expect = 3.2 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 765 KITSMATPTTHSHSEILKRCLENSLEGHHLAVYSLKSTVTITTTGTDAEV 914 +IT+ + ++ K+ + G H+ LK + T G DAE+ Sbjct: 1108 EITAKRNEMRQLYDDVRKKRFTEFMRGFHIITKKLKEMYQMITLGGDAEL 1157 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 25.4 bits (53), Expect = 4.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 734 NSRGRRSANDEDYEYGYANYPFTF 805 N G+R+A D E YAN PF F Sbjct: 536 NPNGQRTAVWRDLEARYANDPFRF 559 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 7.5 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -3 Query: 596 SRLIFCMLSLSLHLWHSGTHQVSCNSPPSQLSLKGCLKNLKITLALPANVLMPTL 432 S+L F +L+ S SCN PP + + L++++ L ++L TL Sbjct: 1611 SKLSFSWNGQEFNLFCSTGSSNSCNRPPKAGEVLIFITELRVSVWLEGHLLSETL 1665 >AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase protein. Length = 309 Score = 24.2 bits (50), Expect = 9.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 686 ERKRRVYDQYGKEGLNNSRGRRSANDEDYEY 778 ER + ++DQ G+E +NN R + N Y Sbjct: 242 ERFKAIHDQTGRELVNNFRSVQPLNTRALVY 272 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 24.2 bits (50), Expect = 9.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 408 KFTCSIFLNLVRSSLHYRHYHS 343 K F+N+VR ++ YR HS Sbjct: 243 KDVSDFFMNVVRDTIRYREEHS 264 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,193,977 Number of Sequences: 2352 Number of extensions: 23001 Number of successful extensions: 108 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 175562640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -