BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030905E5_A01_e385_01.seq (1532 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244... 30 4.2 11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557... 30 4.2 09_02_0036 + 3217163-3217584,3217752-3218322 30 4.2 07_01_1151 - 10822616-10823863 30 5.6 01_07_0288 + 42534552-42534558,42535302-42537280,42537367-425375... 29 9.8 >11_06_0294 + 22022630-22024006,22024109-22024234,22024319-22024423, 22024525-22024659,22024798-22024847,22026487-22026545, 22026819-22026928,22027941-22028174,22028278-22028377, 22028699-22028829,22029834-22029914,22029970-22030128 Length = 888 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 679 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 822 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 446 >11_06_0278 - 21854859-21855101,21855529-21855587,21855684-21855711, 21855812-21856702,21856792-21857011,21857638-21857687, 21863174-21863284,21863379-21863483,21863568-21863693, 21863796-21865187 Length = 1074 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 679 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 822 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 451 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 617 ITIHWPSFYNVV-TGKTLALPNLIALQH 697 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >07_01_1151 - 10822616-10823863 Length = 415 Score = 29.9 bits (64), Expect = 5.6 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 268 STHARRSTLPHPLSKIW-GRRHLSSLNLLSFRLKKSLSQ 155 ST+ ++ T HP+ KIW R++SS N F L Q Sbjct: 376 STNPKKKTSSHPMPKIWKSSRYVSSGNFRCFTSYSQLKQ 414 >01_07_0288 + 42534552-42534558,42535302-42537280,42537367-42537513, 42537982-42538526,42538906-42538981,42539357-42539437 Length = 944 Score = 29.1 bits (62), Expect = 9.8 Identities = 20/62 (32%), Positives = 28/62 (45%) Frame = -2 Query: 313 SSPRSLQAVAACRETSTHARRSTLPHPLSKIWGRRHLSSLNLLSFRLKKSLSQHYPLSSP 134 S +SL +++ E STH+ R + PH R +SS L S K S + S Sbjct: 782 SQHKSLGSISEHSEVSTHSHRVSSPHDTELSNRRARISSDELFSASGKSDDSNNRDARSL 841 Query: 133 QN 128 QN Sbjct: 842 QN 843 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,333,245 Number of Sequences: 37544 Number of extensions: 516324 Number of successful extensions: 1618 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1617 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4930895900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -