Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030905E5_A01_e385_01.seq
         (1532 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g33750.1 68414.m04172 terpene synthase/cyclase family protein...    33   0.66 

>At1g33750.1 68414.m04172 terpene synthase/cyclase family protein
           similar to DELTA-CADINENE SYNTHASE ISOZYME A GB:Q43714
           from [Gossypium arboreum]
          Length = 603

 Score = 32.7 bits (71), Expect = 0.66
 Identities = 23/72 (31%), Positives = 31/72 (43%)
 Frame = -2

Query: 415 TMTRIHISVSLPLKISHLHAHIETLARTHR*LTRSSPRSLQAVAACRETSTHARRSTLPH 236
           T+  +     LPLK + L      L + H  L+R S +    V AC +TS       LPH
Sbjct: 12  TLPHLGNGTRLPLK-TKLSLFPMHLLQNHTTLSRRSTKLNLCVKACSKTSGVESSRPLPH 70

Query: 235 PLSKIWGRRHLS 200
               +WG   LS
Sbjct: 71  SAPDLWGDHILS 82


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,849,396
Number of Sequences: 28952
Number of extensions: 376192
Number of successful extensions: 898
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 864
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 898
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4106040192
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)