SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_H11_e664_15.seq
         (1606 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript...    25   6.1  

>AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1248

 Score = 25.0 bits (52), Expect = 6.1
 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 1/72 (1%)
 Frame = +3

Query: 51  PGSAGNSARGFRNVSFYCYRSYAFIMY-MYKQTTXDYQCSF*NEKSLAKFSYILTSTRYK 227
           P  A NSA  +R +S Y Y  + +I Y + +Q   + Q      +  A     L  TR+ 
Sbjct: 184 PDLAANSATCWRILSRYSYSDHVYIRYTVGEQPPREQQTGTARRQRTA---VRLAGTRWN 240

Query: 228 TTSLKSTLINYA 263
           T     TL   A
Sbjct: 241 TRQFDPTLFESA 252


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 994,503
Number of Sequences: 2352
Number of extensions: 15555
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 68
effective length of database: 404,043
effective search space used: 188284038
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -