BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H07_e632_15.seq (1569 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 9e-18 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 88 2e-17 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 87 5e-17 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 6e-17 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 85 1e-16 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 7e-15 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-14 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 4e-12 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 69 1e-11 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 8e-08 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-07 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-07 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-07 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 55 2e-07 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-07 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-07 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 55 2e-07 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 55 2e-07 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 54 3e-07 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 3e-07 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 54 4e-07 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 54 4e-07 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 54 4e-07 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 54 4e-07 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 54 4e-07 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 54 4e-07 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 54 4e-07 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 54 4e-07 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 54 4e-07 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 54 4e-07 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 54 4e-07 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 54 4e-07 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 54 4e-07 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 54 4e-07 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 54 4e-07 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 54 4e-07 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 54 4e-07 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 54 4e-07 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 54 4e-07 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 54 4e-07 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 54 4e-07 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 54 4e-07 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 54 4e-07 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 54 4e-07 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 54 4e-07 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 54 4e-07 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 54 4e-07 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 54 4e-07 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 54 4e-07 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 54 4e-07 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 54 4e-07 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 54 4e-07 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 54 4e-07 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 54 4e-07 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 54 4e-07 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 54 4e-07 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 54 4e-07 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 54 4e-07 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 54 4e-07 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 54 4e-07 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 54 4e-07 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 54 4e-07 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 54 4e-07 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 54 4e-07 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 54 4e-07 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 54 4e-07 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 54 4e-07 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 54 4e-07 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 54 4e-07 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 54 4e-07 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 54 4e-07 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 54 4e-07 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 54 4e-07 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 54 4e-07 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 54 4e-07 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 54 4e-07 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24401| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_24066| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 54 4e-07 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 54 4e-07 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 54 4e-07 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 54 4e-07 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 54 4e-07 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 54 4e-07 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 54 4e-07 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 54 4e-07 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 54 4e-07 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 54 4e-07 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 54 4e-07 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20543| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 54 4e-07 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 54 4e-07 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 54 4e-07 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 54 4e-07 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 54 4e-07 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 89.0 bits (211), Expect = 9e-18 Identities = 43/63 (68%), Positives = 45/63 (71%) Frame = -3 Query: 715 PXAIQGXXXGXKGRIGAGLFXIPPAGERGMCCKGX*VG*RQGFPSHDVVKRRPVNCNTTH 536 P AIQ + IGAGLF I PAGERGMCCK +G FPSHDVVKRRPVNCNTTH Sbjct: 4 PFAIQAAQLLGRA-IGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTH 62 Query: 535 YRA 527 YRA Sbjct: 63 YRA 65 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 87.8 bits (208), Expect = 2e-17 Identities = 39/49 (79%), Positives = 40/49 (81%) Frame = -3 Query: 673 IGAGLFXIPPAGERGMCCKGX*VG*RQGFPSHDVVKRRPVNCNTTHYRA 527 IGAGLF I PAGERGMCCK +G FPSHDVVKRRPVNCNTTHYRA Sbjct: 3 IGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRA 51 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 86.6 bits (205), Expect = 5e-17 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -3 Query: 673 IGAGLFXIPPAGERGMCCKGX*VG*RQGFPSHDVVKRRPVNCNTTHYRA 527 IGAGLF I PAGERGMCCK +G +GFPSHD KRRPVNCNTTHYRA Sbjct: 48 IGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRA 96 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 86.2 bits (204), Expect = 6e-17 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -3 Query: 664 GLFXIPPAGERGMCCKGX*VG*RQGFPSHDVVKRRPVNCNTTHYRA 527 GLF I PAGERGMCCK +G +GFPSHDVVKRRPVNCNTTHYRA Sbjct: 12 GLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRA 57 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 85.4 bits (202), Expect = 1e-16 Identities = 38/49 (77%), Positives = 39/49 (79%) Frame = -3 Query: 673 IGAGLFXIPPAGERGMCCKGX*VG*RQGFPSHDVVKRRPVNCNTTHYRA 527 IGAGLF I PAGERGMCCK + FPSHDVVKRRPVNCNTTHYRA Sbjct: 11 IGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRA 59 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 82.2 bits (194), Expect = 1e-15 Identities = 42/63 (66%), Positives = 44/63 (69%) Frame = -3 Query: 715 PXAIQGXXXGXKGRIGAGLFXIPPAGERGMCCKGX*VG*RQGFPSHDVVKRRPVNCNTTH 536 P AIQ + IGAGLF I PAGERGMCCK + FPSHDVVKRRPVNCNTTH Sbjct: 1837 PFAIQAAQLLGRA-IGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTH 1894 Query: 535 YRA 527 YRA Sbjct: 1895 YRA 1897 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 79.8 bits (188), Expect = 5e-15 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -3 Query: 673 IGAGLFXIPPAGERGMCCKGX*-VG*RQGFPSHDVVKRRPVNCNTTHYRA 527 IGAGLF I PAGE+G +G +G RQGFPSHDVVKRRPVNCNTTHYRA Sbjct: 51 IGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRA 100 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 79.4 bits (187), Expect = 7e-15 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -2 Query: 671 RXGPLRYSASXRKGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 R GPLRY AS RKGDVLQRR SWVTPGFSQSRRCKTTASEL Sbjct: 10 RCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 76.6 bits (180), Expect = 5e-14 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -2 Query: 671 RXGPLRYSASXRKGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 R GPLRY AS RKGDVLQ R SWVTPGFSQSRRCKTTASEL Sbjct: 10 RCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 70.1 bits (164), Expect = 4e-12 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = -2 Query: 671 RXGPLRYSASXRKGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 R GPLRY AS RKG RR SWVTPGFSQSRRCKTTASEL Sbjct: 70 RCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 68.5 bits (160), Expect = 1e-11 Identities = 32/67 (47%), Positives = 35/67 (52%) Frame = +2 Query: 515 GXXFRPIVSRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXX 694 G RPIVSRITIHWP+FYN TGKT WRN +EAR D P Sbjct: 37 GAPIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP-SQQL 95 Query: 695 XALNGXW 715 +LNG W Sbjct: 96 RSLNGEW 102 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 65.3 bits (152), Expect = 1e-10 Identities = 31/59 (52%), Positives = 32/59 (54%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGKT WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEW 59 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 64.9 bits (151), Expect = 2e-10 Identities = 31/59 (52%), Positives = 32/59 (54%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGKT WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRP-SQQLRSLNGEW 59 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.1 bits (149), Expect = 3e-10 Identities = 31/59 (52%), Positives = 32/59 (54%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGKT WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRP-SQQLRSLNGEW 59 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 64.1 bits (149), Expect = 3e-10 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 637 ERGMCCKGX*VG*RQGFPSHDVVKRRPVNCNTTHYRA 527 ERGMCCK +G F SHDVVKRRPVNCNTTHYRA Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRA 39 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 64.1 bits (149), Expect = 3e-10 Identities = 31/41 (75%), Positives = 31/41 (75%) Frame = -2 Query: 671 RXGPLRYSASXRKGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 R GPLRY AS RKGD R S TPGFSQSRRCKTTASEL Sbjct: 39 RCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.1 bits (149), Expect = 3e-10 Identities = 31/59 (52%), Positives = 32/59 (54%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGKT WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRP-SQRLRSLNGEW 59 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/59 (50%), Positives = 31/59 (52%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGK WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEW 59 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/59 (50%), Positives = 31/59 (52%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGK WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEW 59 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.5 bits (145), Expect = 9e-10 Identities = 30/59 (50%), Positives = 31/59 (52%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGK WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEW 59 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 59.7 bits (138), Expect = 6e-09 Identities = 31/60 (51%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGK-TXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGK T WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRP-SQQLRSLNGEW 60 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 56.8 bits (131), Expect = 4e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 598 RQGFPSHDVVKRRPVNCNTTHYRA 527 R GFPSHDVVKRRPVNCNTTHYRA Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRA 78 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 4e-08 Identities = 27/59 (45%), Positives = 30/59 (50%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNV+ KT WRN E+AR D P +LNG W Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRP-SQQLRSLNGEW 59 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.4 bits (130), Expect = 6e-08 Identities = 30/63 (47%), Positives = 32/63 (50%) Frame = +2 Query: 527 RPIVSRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALN 706 RP+VSRITIHW SFYNVVTGKT EEAR D P +LN Sbjct: 34 RPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRP-SQQLRSLN 92 Query: 707 GXW 715 G W Sbjct: 93 GEW 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 56.4 bits (130), Expect = 6e-08 Identities = 29/62 (46%), Positives = 32/62 (51%) Frame = +2 Query: 530 PIVSRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNG 709 P +SRITIHWPSFYNVVTGKT + EEAR D P +LNG Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRP-SQQLRSLNG 135 Query: 710 XW 715 W Sbjct: 136 EW 137 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 56.0 bits (129), Expect = 8e-08 Identities = 26/54 (48%), Positives = 27/54 (50%) Frame = +2 Query: 554 HWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 HWPSFYNVVTGKT WRN EEAR D P +LNG W Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEW 57 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 55.6 bits (128), Expect = 1e-07 Identities = 29/59 (49%), Positives = 30/59 (50%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGKT N EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRP-SQQLRSLNGEW 59 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 54.8 bits (126), Expect = 2e-07 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 592 GFPSHDVVKRRPVNCNTTHYRA 527 GFPSHDVVKRRPVNCNTTHYRA Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRA 22 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 54.8 bits (126), Expect = 2e-07 Identities = 30/45 (66%), Positives = 30/45 (66%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL*YDSL*GEXGXRAPPR 501 KG RR SWVTPGFSQSRRCKTTASE D L E R PPR Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPLVLE---RPPPR 70 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 83 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 111 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 114 WRNSEEARTDRP-SQQLRSLNGEW 136 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 54.8 bits (126), Expect = 2e-07 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 592 GFPSHDVVKRRPVNCNTTHYRA 527 GFPSHDVVKRRPVNCNTTHYRA Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRA 646 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.8 bits (126), Expect = 2e-07 Identities = 27/59 (45%), Positives = 29/59 (49%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVV + WRN EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEW 59 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.8 bits (126), Expect = 2e-07 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 592 GFPSHDVVKRRPVNCNTTHYRA 527 GFPSHDVVKRRPVNCNTTHYRA Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRA 78 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 54.8 bits (126), Expect = 2e-07 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 592 GFPSHDVVKRRPVNCNTTHYRA 527 GFPSHDVVKRRPVNCNTTHYRA Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRA 89 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 54.8 bits (126), Expect = 2e-07 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 592 GFPSHDVVKRRPVNCNTTHYRA 527 GFPSHDVVKRRPVNCNTTHYRA Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRA 89 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 54.0 bits (124), Expect = 3e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPFRXLAE 651 NSLAVVLQRRDWENPGVTQL RL + PF E Sbjct: 140 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWLE 173 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.0 bits (124), Expect = 3e-07 Identities = 28/59 (47%), Positives = 29/59 (49%) Frame = +2 Query: 539 SRITIHWPSFYNVVTGKTXXXXXXXXXXXXXXXXXWRNXEEARXDXPLXTXXXALNGXW 715 SRITIHWPSFYNVVTGKT EEAR D P +LNG W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRP-SQQLRSLNGEW 59 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 33 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 64 WRNSEEARTDRP-SQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 42 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 70 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 73 WRNSEEARTDRP-SQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 34 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 65 WRNSEEARTDRP-SQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 60 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 88 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 91 WRNSEEARTDRP-SQQLRSLNGEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 65 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 93 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 96 WRNSEEARTDRP-SQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 36 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 67 WRNSEEARTDRP-SQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 56 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 87 WRNSEEARTDRP-SQQLRSLNGEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 68 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 96 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 99 WRNSEEARTDRP-SQQLRSLNGEW 121 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 44 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 72 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 75 WRNSEEARTDRP-SQQLRSLNGEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 33 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 64 WRNSEEARTDRP-SQQLRSLNGEW 86 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 48 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 79 WRNSEEARTDRP-SQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 57 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 85 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 88 WRNSEEARTDRP-SQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 51 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 79 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 82 WRNSEEARTDRP-SQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 67 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 95 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 98 WRNSEEARTDRP-SQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 55 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 86 WRNSEEARTDRP-SQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 38 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 66 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 69 WRNSEEARTDRP-SQQLRSLNGEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 214 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 242 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 245 WRNSEEARTDRP-SQQLRSLNGEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 109 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 137 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 140 WRNSEEARTDRP-SQQLRSLNGEW 162 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 45 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 73 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 76 WRNSEEARTDRP-SQQLRSLNGEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 379 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 407 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 410 WRNSEEARTDRP-SQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 105 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 133 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 136 WRNSEEARTDRP-SQQLRSLNGEW 158 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 81 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 109 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 112 WRNSEEARTDRP-SQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 37 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 68 WRNSEEARTDRP-SQQLRSLNGEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 6 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 34 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 37 WRNSEEARTDRP-SQQLRSLNGEW 59 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 36 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 67 WRNSEEARTDRP-SQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 101 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 129 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 132 WRNSEEARTDRP-SQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 43 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 71 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 74 WRNSEEARTDRP-SQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 338 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 366 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 369 WRNSEEARTDRP-SQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 78 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 106 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 109 WRNSEEARTDRP-SQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 48 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 79 WRNSEEARTDRP-SQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 57 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 85 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 88 WRNSEEARTDRP-SQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 41 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 72 WRNSEEARTDRP-SQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 132 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 160 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 163 WRNSEEARTDRP-SQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 61 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 89 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 92 WRNSEEARTDRP-SQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 37 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 68 WRNSEEARTDRP-SQQLRSLNGEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 141 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 169 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 172 WRNSEEARTDRP-SQQLRSLNGEW 194 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 58 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 86 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 89 WRNSEEARTDRP-SQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 32 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 63 WRNSEEARTDRP-SQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 71 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 99 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 102 WRNSEEARTDRP-SQQLRSLNGEW 124 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 65 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 93 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 54 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 82 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 85 WRNSEEARTDRP-SQQLRSLNGEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 67 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 95 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 98 WRNSEEARTDRP-SQQLRSLNGEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 254 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 282 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 285 WRNSEEARTDRP-SQQLRSLNGEW 307 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 48 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 79 WRNSEEARTDRP-SQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 34 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 65 WRNSEEARTDRP-SQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 35 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 63 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 66 WRNSEEARTDRP-SQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 99 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 127 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 130 WRNSEEARTDRP-SQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 112 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 140 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 143 WRNSEEARTDRP-SQQLRSLNGEW 165 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 56 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 87 WRNSEEARTDRP-SQQLRSLNGEW 109 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 241 KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 32 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 63 WRNSEEARTDRP-SQQLRSLNGEW 85 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 394 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 422 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 425 WRNSEEARTDRP-SQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 43 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 71 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 74 WRNSEEARTDRP-SQQLRSLNGEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 52 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 80 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 83 WRNSEEARTDRP-SQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 34 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 65 WRNSEEARTDRP-SQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 117 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 145 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 148 WRNSEEARTDRP-SQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 53 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 81 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 84 WRNSEEARTDRP-SQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 63 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 91 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 94 WRNSEEARTDRP-SQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 66 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 94 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 97 WRNSEEARTDRP-SQQLRSLNGEW 119 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 412 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 440 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 443 WRNSEEARTDRP-SQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 109 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 137 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 140 WRNSEEARTDRP-SQQLRSLNGEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 65 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 93 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 96 WRNSEEARTDRP-SQQLRSLNGEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 54 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 82 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 85 WRNSEEARTDRP-SQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 44 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 72 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 75 WRNSEEARTDRP-SQQLRSLNGEW 97 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 47 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 75 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 159 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 187 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 190 WRNSEEARTDRP-SQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 63 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 91 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 94 WRNSEEARTDRP-SQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 50 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 78 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 81 WRNSEEARTDRP-SQQLRSLNGEW 103 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 61 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 89 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 92 WRNSEEARTDRP-SQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 40 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 68 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 71 WRNSEEARTDRP-SQQLRSLNGEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 183 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 211 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 214 WRNSEEARTDRP-SQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 32 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 63 WRNSEEARTDRP-SQQLRSLNGEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 38 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 66 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 69 WRNSEEARTDRP-SQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 52 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 80 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 83 WRNSEEARTDRP-SQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 49 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 77 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 80 WRNSEEARTDRP-SQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 32 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 60 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 63 WRNSEEARTDRP-SQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 33 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 64 WRNSEEARTDRP-SQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 47 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 75 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 78 WRNSEEARTDRP-SQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 37 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 68 WRNSEEARTDRP-SQQLRSLNGEW 90 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 39 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 67 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 70 WRNSEEARTDRP-SQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 82 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 110 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 113 WRNSEEARTDRP-SQQLRSLNGEW 135 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 338 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 366 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 369 WRNSEEARTDRP-SQQLRSLNGEW 391 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 107 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 135 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 138 WRNSEEARTDRP-SQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 84 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 112 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 115 WRNSEEARTDRP-SQQLRSLNGEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 34 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 65 WRNSEEARTDRP-SQQLRSLNGEW 87 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 292 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 320 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 323 WRNSEEARTDRP-SQQLRSLNGEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 55 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 86 WRNSEEARTDRP-SQQLRSLNGEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 56 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 87 WRNSEEARTDRP-SQQLRSLNGEW 109 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 34 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 65 WRNSEEARTDRP-SQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 409 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 437 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 440 WRNSEEARTDRP-SQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 93 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 121 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 124 WRNSEEARTDRP-SQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 49 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 77 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 80 WRNSEEARTDRP-SQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 41 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 72 WRNSEEARTDRP-SQQLRSLNGEW 94 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 91 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 119 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 122 WRNSEEARTDRP-SQQLRSLNGEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 41 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 72 WRNSEEARTDRP-SQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 209 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 237 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 240 WRNSEEARTDRP-SQQLRSLNGEW 262 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 41 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 72 WRNSEEARTDRP-SQQLRSLNGEW 94 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 36 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 67 WRNSEEARTDRP-SQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 41 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 72 WRNSEEARTDRP-SQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 145 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 173 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 176 WRNSEEARTDRP-SQQLRSLNGEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 43 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 71 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 74 WRNSEEARTDRP-SQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 33 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 61 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 64 WRNSEEARTDRP-SQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 53 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 81 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 84 WRNSEEARTDRP-SQQLRSLNGEW 106 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 193 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 221 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 224 WRNSEEARTDRP-SQQLRSLNGEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 51 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 79 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 82 WRNSEEARTDRP-SQQLRSLNGEW 104 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 30 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 58 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 61 WRNSEEARTDRP-SQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 84 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 112 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 115 WRNSEEARTDRP-SQQLRSLNGEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 47 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 75 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 78 WRNSEEARTDRP-SQQLRSLNGEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 185 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 213 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 216 WRNSEEARTDRP-SQQLRSLNGEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 55 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 86 WRNSEEARTDRP-SQQLRSLNGEW 108 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 65 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 93 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 96 WRNSEEARTDRP-SQQLRSLNGEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 48 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 79 WRNSEEARTDRP-SQQLRSLNGEW 101 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 74 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 102 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 105 WRNSEEARTDRP-SQQLRSLNGEW 127 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 21 KGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 94 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 122 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 125 WRNSEEARTDRP-SQQLRSLNGEW 147 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 396 KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 38 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 66 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 69 WRNSEEARTDRP-SQQLRSLNGEW 91 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 47 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 75 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 78 WRNSEEARTDRP-SQQLRSLNGEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 661 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 689 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 692 WRNSEEARTDRP-SQQLRSLNGEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 46 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 74 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 77 WRNSEEARTDRP-SQQLRSLNGEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 35 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 63 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 66 WRNSEEARTDRP-SQQLRSLNGEW 88 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 36 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 64 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 67 WRNSEEARTDRP-SQQLRSLNGEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 34 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 65 WRNSEEARTDRP-SQQLRSLNGEW 87 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 41 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 72 WRNSEEARTDRP-SQQLRSLNGEW 94 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 40 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 68 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 71 WRNSEEARTDRP-SQQLRSLNGEW 93 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 54 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 82 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 85 WRNSEEARTDRP-SQQLRSLNGEW 107 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 48 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 79 WRNSEEARTDRP-SQQLRSLNGEW 101 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 124 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 152 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 155 WRNSEEARTDRP-SQQLRSLNGEW 177 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 166 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 194 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 197 WRNSEEARTDRP-SQQLRSLNGEW 219 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 78 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 106 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 109 WRNSEEARTDRP-SQQLRSLNGEW 131 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 28 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 56 Score = 29.9 bits (64), Expect = 5.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P LNG W Sbjct: 59 WRNSEEARTDRP-SQQLRTLNGEW 81 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 43 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 71 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 74 WRNSEEARTDRP-SQQLRSLNGEW 96 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 73 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 101 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 104 WRNSEEARTDRP-SQQLRSLNGEW 126 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 923 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 951 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 954 WRNSEEARTDRP-SQQLRSLNGEW 976 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 44 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 72 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 75 WRNSEEARTDRP-SQQLRSLNGEW 97 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 34 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 62 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 65 WRNSEEARTDRP-SQQLRSLNGEW 87 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 351 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 379 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 382 WRNSEEARTDRP-SQQLRSLNGEW 404 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 81 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 109 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 112 WRNSEEARTDRP-SQQLRSLNGEW 134 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 63 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 91 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 94 WRNSEEARTDRP-SQQLRSLNGEW 116 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 73 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 101 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 104 WRNSEEARTDRP-SQQLRSLNGEW 126 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 6 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 34 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 37 WRNSEEARTDRP-SQQLRSLNGEW 59 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 124 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 152 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 155 WRNSEEARTDRP-SQQLRSLNGEW 177 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 1471 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 1499 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 1502 WRNSEEARTDRP-SQQLRSLNGEW 1524 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 95 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 123 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 126 WRNSEEARTDRP-SQQLRSLNGEW 148 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 55 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 83 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 86 WRNSEEARTDRP-SQQLRSLNGEW 108 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 635 KGDVLQRRXSWVTPGFSQSRRCKTTASEL 549 KG RR SWVTPGFSQSRRCKTTASEL Sbjct: 312 KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 52 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 80 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 83 WRNSEEARTDRP-SQQLRSLNGEW 105 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 102 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 130 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 133 WRNSEEARTDRP-SQQLRSLNGEW 155 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 45 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 73 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 76 WRNSEEARTDRP-SQQLRSLNGEW 98 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 906 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 934 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 937 WRNSEEARTDRP-SQQLRSLNGEW 959 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 37 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 68 WRNSEEARTDRP-SQQLRSLNGEW 90 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 41 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 69 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 72 WRNSEEARTDRP-SQQLRSLNGEW 94 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 39 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 67 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 70 WRNSEEARTDRP-SQQLRSLNGEW 92 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 79 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 107 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 110 WRNSEEARTDRP-SQQLRSLNGEW 132 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 87 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 115 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 118 WRNSEEARTDRP-SQQLRSLNGEW 140 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 461 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 489 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 492 WRNSEEARTDRP-SQQLRSLNGEW 514 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 54 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 82 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 85 WRNSEEARTDRP-SQQLRSLNGEW 107 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 48 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 76 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 79 WRNSEEARTDRP-SQQLRSLNGEW 101 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 50 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 78 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 81 WRNSEEARTDRP-SQQLRSLNGEW 103 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 94 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 122 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 125 WRNSEEARTDRP-SQQLRSLNGEW 147 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 73 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 101 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 104 WRNSEEARTDRP-SQQLRSLNGEW 126 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 56 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 84 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 87 WRNSEEARTDRP-SQQLRSLNGEW 109 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 69 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 97 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 100 WRNSEEARTDRP-SQQLRSLNGEW 122 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 45 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 73 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 76 WRNSEEARTDRP-SQQLRSLNGEW 98 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 51 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 79 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 82 WRNSEEARTDRP-SQQLRSLNGEW 104 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 27 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 55 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 58 WRNSEEARTDRP-SQQLRSLNGEW 80 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 54 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 82 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 85 WRNSEEARTDRP-SQQLRSLNGEW 107 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 52 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 80 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 83 WRNSEEARTDRP-SQQLRSLNGEW 105 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 37 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 65 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 68 WRNSEEARTDRP-SQQLRSLNGEW 90 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 110 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 138 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 141 WRNSEEARTDRP-SQQLRSLNGEW 163 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 53.6 bits (123), Expect = 4e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 550 NSLAVVLQRRDWENPGVTQLXRLCSTSPF 636 NSLAVVLQRRDWENPGVTQL RL + PF Sbjct: 60 NSLAVVLQRRDWENPGVTQLNRLAAHPPF 88 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 644 WRNXEEARXDXPLXTXXXALNGXW 715 WRN EEAR D P +LNG W Sbjct: 91 WRNSEEARTDRP-SQQLRSLNGEW 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,786,932 Number of Sequences: 59808 Number of extensions: 280375 Number of successful extensions: 7268 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7246 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5129408549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -