BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H07_e632_15.seq (1569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 33 0.017 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 30 0.16 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 33.5 bits (73), Expect = 0.017 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 7/51 (13%) Frame = +1 Query: 208 SEIEKQFVEIKKQVQENFK-PDN------VKKQFNNMVDDFNXFMSSMNPN 339 S+I+KQF ++K+ VQE + DN + F ++ +DFN F+S++NP+ Sbjct: 3199 SQIDKQFHDLKQTVQEYRQLADNRNSGNWLDNIFKDIKEDFNVFLSTVNPS 3249 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 30.3 bits (65), Expect = 0.16 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 7/49 (14%) Frame = +1 Query: 208 SEIEKQFVEIKKQVQENFK-PDN------VKKQFNNMVDDFNXFMSSMN 333 S+I+KQF ++K+ VQE + DN + F ++ +DFN F+S++N Sbjct: 3196 SQIDKQFHDLKQTVQEYRQLADNRNSGNWLDNIFKDIEEDFNVFLSTVN 3244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,588 Number of Sequences: 2352 Number of extensions: 9431 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 184909725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -