BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H04_e608_16.seq (1587 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 141 8e-46 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 3e-19 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 89 1e-17 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 6e-17 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 8e-16 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 2e-14 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-14 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 9e-14 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 75 1e-13 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 2e-13 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 75 2e-13 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 2e-13 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 74 4e-13 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 4e-13 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 74 4e-13 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 74 4e-13 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 4e-13 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-12 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 8e-12 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 67 4e-11 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 64 2e-10 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-10 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 8e-09 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 1e-08 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 1e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 1e-08 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-07 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 6e-07 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 53 6e-07 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 6e-07 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-07 SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) 52 1e-06 SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) 52 1e-06 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 51 2e-06 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-06 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 50 4e-06 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 50 5e-06 SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-06 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 50 7e-06 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 50 7e-06 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 49 9e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 49 9e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 49 9e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 49 9e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 49 9e-06 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 49 9e-06 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 49 9e-06 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 49 9e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 49 9e-06 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 49 9e-06 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 49 9e-06 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 49 9e-06 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 49 9e-06 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 49 9e-06 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 49 9e-06 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 49 9e-06 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 49 9e-06 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 49 9e-06 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 49 9e-06 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 49 9e-06 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 49 9e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 49 9e-06 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 49 9e-06 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 49 9e-06 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 49 9e-06 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 49 9e-06 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 49 9e-06 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 49 9e-06 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 49 9e-06 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 49 9e-06 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 49 9e-06 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 49 9e-06 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 49 9e-06 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 49 9e-06 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 49 9e-06 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 49 9e-06 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 49 9e-06 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 49 9e-06 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 49 9e-06 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 49 9e-06 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 49 9e-06 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 49 9e-06 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 49 9e-06 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 49 9e-06 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 49 9e-06 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 49 9e-06 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 49 9e-06 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 49 9e-06 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 49 9e-06 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 49 9e-06 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 49 9e-06 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 49 9e-06 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 49 9e-06 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 49 9e-06 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 49 9e-06 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 49 9e-06 SB_38657| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_58324| Best HMM Match : Keratin_B2 (HMM E-Value=0.47) 49 1e-05 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50509| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_23295| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) 48 2e-05 SB_16085| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 48 2e-05 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 48 3e-05 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 48 3e-05 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 48 3e-05 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 48 3e-05 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 48 3e-05 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 48 3e-05 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 48 3e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 48 3e-05 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 48 3e-05 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 48 3e-05 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 48 3e-05 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 48 3e-05 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 48 3e-05 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 48 3e-05 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 48 3e-05 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 48 3e-05 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 48 3e-05 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 48 3e-05 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 48 3e-05 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 48 3e-05 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 48 3e-05 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 48 3e-05 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 48 3e-05 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 141 bits (341), Expect(2) = 8e-46 Identities = 68/96 (70%), Positives = 84/96 (87%) Frame = +1 Query: 154 ISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAFQKIQIRLVREL 333 ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP+P+++AFQKIQ RLVREL Sbjct: 26 ISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVPVPQIRAFQKIQTRLVREL 85 Query: 334 EKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 441 EKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 86 EKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 62.5 bits (145), Expect(2) = 8e-46 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 553 HLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFP 654 HLDK QQTTI+HK++TF +VYKKLTG++V FEFP Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 93.9 bits (223), Expect = 3e-19 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 932 LPFAIQAAQLLEXRSVRAXL-AITPAGERGXXAXRLSWVTPGFPSHDVVKRRPVXCNTTH 756 +PFAIQAAQLL R++ A L AITPAGERG + VTP FPSHDVVKRRPV CNTTH Sbjct: 1836 VPFAIQAAQLL-GRAIGAGLFAITPAGERGMCCKAIKLVTPVFPSHDVVKRRPVNCNTTH 1894 Query: 755 YRANW 741 YRANW Sbjct: 1895 YRANW 1899 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 88.6 bits (210), Expect = 1e-17 Identities = 45/71 (63%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Frame = +3 Query: 720 TRGGARYPIRPIVSRITXHWPSFYNVVTGKPWRYPT*S-XCXXPPFASWRNSQXGPHRSP 896 T GGA PIRPIVSRIT HWP+FYN TGK Y + PPFASWRNSQ P Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP 91 Query: 897 FQQLRSLNGEW 929 QQLRSLNGEW Sbjct: 92 SQQLRSLNGEW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 86.2 bits (204), Expect = 6e-17 Identities = 38/53 (71%), Positives = 40/53 (75%) Frame = -2 Query: 899 EXRSVRAXLAITPAGERGXXAXRLSWVTPGFPSHDVVKRRPVXCNTTHYRANW 741 E RSVRA + + G A RLSWVTPGFPSHDVVKRRPV CNTTHYRANW Sbjct: 28 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 33.9 bits (74), Expect = 0.36 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -3 Query: 916 RLRNCWXGDRCGPXWLLRQLAKGG 845 +LRNCW G LLRQLAKGG Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGG 45 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 82.6 bits (195), Expect = 8e-16 Identities = 44/66 (66%), Positives = 48/66 (72%), Gaps = 2/66 (3%) Frame = -2 Query: 932 LPFAIQAAQLLEXRSVRAXL-AITPAGERGXXAXRLSWVTPG-FPSHDVVKRRPVXCNTT 759 +PFAIQAAQLL R++ A L AITPAGERG + FPSHDVVKRRPV CNTT Sbjct: 3 VPFAIQAAQLL-GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTT 61 Query: 758 HYRANW 741 HYRANW Sbjct: 62 HYRANW 67 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 78.2 bits (184), Expect = 2e-14 Identities = 37/58 (63%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*-SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK P + PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 76.6 bits (180), Expect = 5e-14 Identities = 37/58 (63%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*SXCXX-PPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK P PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 75.8 bits (178), Expect = 9e-14 Identities = 37/58 (63%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGK-PWRYPT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK P PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 75.4 bits (177), Expect = 1e-13 Identities = 42/70 (60%), Positives = 43/70 (61%) Frame = +3 Query: 720 TRGGARYPIRPIVSRITXHWPSFYNVVTGKPWRYPT*SXCXXPPFASWRNSQXGPHRSPF 899 T GGA PIRPIVS IT HWPSFYN VT P PFASWRNS+ P Sbjct: 36 TVGGA--PIRPIVSHITIHWPSFYNGVTAHP------------PFASWRNSEEARTDRPS 81 Query: 900 QQLRSLNGEW 929 QQLRSLNGEW Sbjct: 82 QQLRSLNGEW 91 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 74.9 bits (176), Expect = 2e-13 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*SXCXX-PPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK P PPFASWRNS+ P Q+LRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 74.5 bits (175), Expect = 2e-13 Identities = 40/62 (64%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = -2 Query: 920 IQAAQLLEXRSVRAXL-AITPAGERGXXAXRLSWVTPG-FPSHDVVKRRPVXCNTTHYRA 747 +QAAQLL R++ A L AITPAGERG + FPSHDVVKRRPV CNTTHYRA Sbjct: 1 MQAAQLL-GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRA 59 Query: 746 NW 741 NW Sbjct: 60 NW 61 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.5 bits (175), Expect = 2e-13 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*SXCXX-PPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK + PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 73.7 bits (173), Expect = 4e-13 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -2 Query: 899 EXRSVRAXLAITPAGERGXXAXRLSWVTPGFPSHDVVKRRPVXCNTTHYRANW 741 E RSVRA + + G A RLSW GFPSHDVVKRRPV CNTTHYRANW Sbjct: 599 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 648 Score = 45.6 bits (103), Expect = 1e-04 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 928 HSPFRLRNCWXGDRCGPXWLLRQLAKGG 845 HSPFRLRNCW G LLRQLAKGG Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGG 616 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 73.7 bits (173), Expect = 4e-13 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*SXCXX-PPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK + PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 73.7 bits (173), Expect = 4e-13 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -2 Query: 899 EXRSVRAXLAITPAGERGXXAXRLSWVTPGFPSHDVVKRRPVXCNTTHYRANW 741 E RSVRA + + G A RLSW GFPSHDVVKRRPV CNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 Score = 45.6 bits (103), Expect = 1e-04 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 928 HSPFRLRNCWXGDRCGPXWLLRQLAKGG 845 HSPFRLRNCW G LLRQLAKGG Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGG 59 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 73.7 bits (173), Expect = 4e-13 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -2 Query: 899 EXRSVRAXLAITPAGERGXXAXRLSWVTPGFPSHDVVKRRPVXCNTTHYRANW 741 E RSVRA + + G A RLSW GFPSHDVVKRRPV CNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 Score = 45.6 bits (103), Expect = 1e-04 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 928 HSPFRLRNCWXGDRCGPXWLLRQLAKGG 845 HSPFRLRNCW G LLRQLAKGG Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGG 59 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 73.7 bits (173), Expect = 4e-13 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*SXCXX-PPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK + PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 71.7 bits (168), Expect = 1e-12 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 4/63 (6%) Frame = -2 Query: 917 QAAQLLEXRSVRAXL-AITPAGERGXXAX---RLSWVTPGFPSHDVVKRRPVXCNTTHYR 750 QAAQLL R++ A L AITPAGE+G +L GFPSHDVVKRRPV CNTTHYR Sbjct: 42 QAAQLL-GRAIGAGLFAITPAGEKGDVLQGDLKLG-KRQGFPSHDVVKRRPVNCNTTHYR 99 Query: 749 ANW 741 ANW Sbjct: 100 ANW 102 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 69.7 bits (163), Expect = 6e-12 Identities = 34/58 (58%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGK-PWRYPT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNV+ K P PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 59 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 69.3 bits (162), Expect = 8e-12 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 872 AITPAGERGXXAXRLSWVTP-GFPSHDVVKRRPVXCNTTHYRANW 741 AITPAGERG + GFPSHDVVKRRPV CNTTHYRANW Sbjct: 15 AITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 35.9 bits (79), Expect = 0.090 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -1 Query: 912 CATVGXAIGAGLFGYYASWRKGDXCXAIKLGNAR 811 CATVG GLF + +G C AIKLGNA+ Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAK 35 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.9 bits (161), Expect = 1e-11 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 774 HWPSFYNVVTGKPWRYPT*SXCXX-PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 HWPSFYNVVTGK + PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 68.1 bits (159), Expect = 2e-11 Identities = 34/58 (58%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGK-PWRYPT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVV + P PPFASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 2e-11 Identities = 35/66 (53%), Positives = 39/66 (59%), Gaps = 4/66 (6%) Frame = +3 Query: 744 IRPIVSRITXHWPSFYNVVTGKPWRYPT*SX----CXXPPFASWRNSQXGPHRSPFQQLR 911 IRPIVSRIT HWPSFY + W P + PPFASWR+S+ P QQLR Sbjct: 18 IRPIVSRITIHWPSFYK---RRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQLR 74 Query: 912 SLNGEW 929 LNGEW Sbjct: 75 RLNGEW 80 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/59 (61%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGK-PWRYPT*SXCXXPPF-ASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK R P+ P ASWRNS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNGEW 60 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 66.9 bits (156), Expect = 4e-11 Identities = 31/45 (68%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -2 Query: 872 AITPAGERGXXAXRLSWVTPG-FPSHDVVKRRPVXCNTTHYRANW 741 AITPAGERG + FPSHDVVKRRPV CNTTHYRANW Sbjct: 9 AITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = -1 Query: 894 AIGAGLFGYYASWRKGDXCXAIKLGNARVSQS 799 AIGAGLF + +G C AIKLGNA V S Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLGNASVFPS 33 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 64.5 bits (150), Expect = 2e-10 Identities = 37/60 (61%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = -2 Query: 917 QAAQLLEXRSVRAXL-AITPAGERGXXAXRLSWVTP-GFPSHDVVKRRPVXCNTTHYRAN 744 + AQLL RS+ A L AITPAGERG + GFPSHD KRRPV CNTTHYRAN Sbjct: 39 RVAQLL-GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 Score = 37.1 bits (82), Expect = 0.039 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = -1 Query: 924 RHSGCATVGXAIGAGLFGYYASWRKGDXCXAIKLGNAR 811 R+ +G +IGAGLF + +G C AIKLGNAR Sbjct: 37 RYRVAQLLGRSIGAGLFAITPAGERGMCCKAIKLGNAR 74 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 63.7 bits (148), Expect = 4e-10 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 914 AAQLLEXRSVRAXLAITPAGERGXXAXRLSWVTP-GFPSHDVVKRRPVXCNTTHYRANW 741 A QL+ +V LA TP+G++ + + FPSHDVVKRRPV CNTTHYRANW Sbjct: 1 AEQLIPRETVAVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.9 bits (141), Expect = 3e-09 Identities = 32/58 (55%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT-*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK P P +AS S+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 59.7 bits (138), Expect = 6e-09 Identities = 31/63 (49%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +3 Query: 744 IRPIVSRITXHWPSFYNVVTGKPWRYPT*SXCXXPPFA-SWRNSQXGPHRSPFQQLRSLN 920 +RP+VSRIT HW SFYNVVTGK P P + + ++ P QQLRSLN Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 921 GEW 929 GEW Sbjct: 93 GEW 95 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 59.3 bits (137), Expect = 8e-09 Identities = 31/58 (53%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*SXCXXPPFA-SWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK P P + + NS+ P QQLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 58.8 bits (136), Expect = 1e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -2 Query: 812 GFPSHDVVKRRPVXCNTTHYRANW 741 GFPSHDVVKRRPV CNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 58.8 bits (136), Expect = 1e-08 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = +3 Query: 756 VSRITXHWPSFYNVVTGKPWRYPT*SX----CXXPPFASWRNSQXGPHRSPFQQLRSLNG 923 +SRIT HWPS V+ + W P + PPFASWRNS+ P QQLRSLNG Sbjct: 277 LSRITIHWPS---VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 333 Query: 924 EW 929 EW Sbjct: 334 EW 335 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 58.8 bits (136), Expect = 1e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -2 Query: 812 GFPSHDVVKRRPVXCNTTHYRANW 741 GFPSHDVVKRRPV CNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 928 HSPFRLRNCWXG 893 HSPFRLRNCW G Sbjct: 43 HSPFRLRNCWEG 54 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 58.4 bits (135), Expect = 1e-08 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = +3 Query: 750 PIVSRITXHWPSFYNVVTGKPWRYPT*SXCXXPPFA-SWRNSQXGPHRSPFQQLRSLNGE 926 P +SRIT HWPSFYNVVTGK P P + + + + P QQLRSLNGE Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 927 W 929 W Sbjct: 137 W 137 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 57.2 bits (132), Expect = 3e-08 Identities = 28/56 (50%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +3 Query: 774 HWPSFYNVVTGKPWRYPT*SXCXXPPFA-SWRNSQXGPHRSPFQQLRSLNGEWQIV 938 HWPSFYNVVTGK P P + + RNS+ P QQLRSLNGEW+++ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 56.4 bits (130), Expect = 6e-08 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = -1 Query: 915 GCATVGXAIGAGLFGYYASWRKGDXCXAIKLGNAR--VSQSRRCKTTASE 772 GCATVG G YYASWRKGD A +L A SQSRRCKTTASE Sbjct: 30 GCATVGKGDRCGPLRYYASWRKGD-ATASRLSGATPGFSQSRRCKTTASE 78 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 55.6 bits (128), Expect = 1e-07 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = -2 Query: 938 YNLPFAIQAAQLLEXRSVRAXLAITPAGERGXXAXRLSWVTPGF 807 + PFAIQAAQLLE RSVRA + + G A RLSWVTPGF Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.4 bits (125), Expect = 2e-07 Identities = 28/48 (58%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 789 YNVVTGK-PWRYPT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 YNVVTGK P PPFASWRNS+ P QQLRSLNGEW Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 53.2 bits (122), Expect = 6e-07 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 938 YNLPFAIQAAQLLEXRSVRAXLAITPAGERGXXAXRLSWVTPGF 807 + PFAIQAAQL E RSVRA + + G A RLSWVTPGF Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 53.2 bits (122), Expect = 6e-07 Identities = 33/75 (44%), Positives = 38/75 (50%), Gaps = 8/75 (10%) Frame = +3 Query: 729 GARYPIRPIVSRITXHWPSFYN----VVTGKPWRYPT*SX----CXXPPFASWRNSQXGP 884 G YP P SR H S+YN V+ + W P + PPFASWRNS+ Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 98 Query: 885 HRSPFQQLRSLNGEW 929 P QQLRSLNGEW Sbjct: 99 TDRPSQQLRSLNGEW 113 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 53.2 bits (122), Expect = 6e-07 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 938 YNLPFAIQAAQLLEXRSVRAXLAITPAGERGXXAXRLSWVTPGF 807 + PFAIQAAQL E RSVRA + + G A RLSWVTPGF Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 52.8 bits (121), Expect = 7e-07 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +3 Query: 750 PIVSRITXHWPSFYNVVTGKPWRYPT*SX----CXXPPFASWRNSQXGPHRSPFQQLRSL 917 P++ R+ ++ S V+ + W P + PPFASWRNS+ P QQLRSL Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 109 Query: 918 NGEW 929 NGEW Sbjct: 110 NGEW 113 >SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) Length = 696 Score = 52.4 bits (120), Expect = 1e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +3 Query: 813 WRY-PT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 +RY P S C PPFASWRNS+ P QQLRSLNGEW Sbjct: 268 FRYCPFVSGCPHPPFASWRNSEEARTDRPSQQLRSLNGEW 307 >SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) Length = 93 Score = 52.4 bits (120), Expect = 1e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = +3 Query: 798 VTGKPWRYPT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 V +P P+ S PPFASWRNS+ P QQLRSLNGEW Sbjct: 10 VASRPNPVPSPSDAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 53 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 52.0 bits (119), Expect = 1e-06 Identities = 24/48 (50%), Positives = 29/48 (60%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIVXVXFXXNSR*IFGKSAH 989 PPFASWRNS+ P QQLRSLNGEW+++ + GKS H Sbjct: 95 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCEYEGKSGH 142 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 82 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 112 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 51.2 bits (117), Expect = 2e-06 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -1 Query: 912 CATVGXAIGAGLFGYYASWRKGDXCXA-IKLGNARVSQSRRCKTTASE 772 CATVG G YYASWRKGD + SQSRRCKTTASE Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASE 49 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 51.2 bits (117), Expect = 2e-06 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +3 Query: 759 SRITXHWPSFYNVVTGKPWRYPT*SXCXXPPF--ASWRNSQXGPHRSPFQQLRSLNGEW 929 SRIT HWPSFYNVVTGK P P A + P P +QLRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP-KQLRSLNGEW 59 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 50.8 bits (116), Expect = 3e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -3 Query: 928 HSPFRLRNCWXGDRCGPXWLLRQLAKGGXLQXD 830 HSPFRLRNCW GDRCGP KG LQ D Sbjct: 32 HSPFRLRNCWEGDRCGPLRYYASWRKGDVLQGD 64 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 50.4 bits (115), Expect = 4e-06 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 8/60 (13%) Frame = +3 Query: 774 HWPSFYN----VVTGKPWRYPT*SX----CXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 H+ S+YN V+ + W P + PPFASWRNS+ P QQLRSLNGEW Sbjct: 1465 HYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 1524 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 50.0 bits (114), Expect = 5e-06 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = +3 Query: 795 VVTGKPWRYPT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 V+ P R+ + S PPFASWRNS+ P QQLRSLNGEW Sbjct: 43 VLERPPPRWSSNSPYTHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 50.0 bits (114), Expect = 5e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 816 RYPT*SXCXXPPFASWRNSQXGPHRSPFQQLRSLNGEW 929 R P S PPFASWRNS+ P QQLRSLNGEW Sbjct: 22 RAPLGSIVAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 49.6 bits (113), Expect = 7e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 800 HDVVKRRPVXCNTTHYRANW 741 HDVVKRRPV CNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 49.6 bits (113), Expect = 7e-06 Identities = 32/84 (38%), Positives = 39/84 (46%), Gaps = 15/84 (17%) Frame = +3 Query: 723 RGGARYPIRPIVSRITXHWPS-------FYN----VVTGKPWRYPT*SX----CXXPPFA 857 + G R PI + R W S +YN V+ + W P + PPFA Sbjct: 46 KNGQRAPINDFLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA 105 Query: 858 SWRNSQXGPHRSPFQQLRSLNGEW 929 SWRNS+ P QQLRSLNGEW Sbjct: 106 SWRNSEEARTDRPSQQLRSLNGEW 129 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 49.6 bits (113), Expect = 7e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 800 HDVVKRRPVXCNTTHYRANW 741 HDVVKRRPV CNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 49.6 bits (113), Expect = 7e-06 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIVXVXF 950 PPFASWRNS+ P QQLRSLNGEW+++ + Sbjct: 553 PPFASWRNSEEARTDRPSQQLRSLNGEWRLMRARY 587 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 540 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 570 Score = 31.9 bits (69), Expect = 1.5 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = +2 Query: 719 NSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 N RG P+ + LAVVLQRRDWE + L L P Sbjct: 512 NQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 553 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 39 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 Score = 36.3 bits (80), Expect = 0.068 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = +1 Query: 775 TGRRFTTS*LGNPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 TGRR NPGVTQLNR A P + ++ ARTDR S Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 56 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 73 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 103 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 49 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 36 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 66 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHP 49 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = +1 Query: 775 TGRRFTTS*LGNPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 TGRRFT NPGVTQLNR A P + ++ ARTDR S Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 103 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 60 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 52 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 82 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 39 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 69 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 53 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 40 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 29 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 59 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 857 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 887 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/60 (36%), Positives = 30/60 (50%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXSNSCAA*MANGKLXALXFXXIXVKFLVNQL 987 NPGVTQLNR A P + ++ ARTDR S + NG+ + + + L N L Sbjct: 844 NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS--LNGEWRLMRYFLLTHLILCNTL 901 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = +2 Query: 722 SRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 SRG P+ + LAVVLQRRDWE + L L P Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 857 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 138 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 168 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 125 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 155 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 93 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 50 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 31 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 35 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 65 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 22 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 52 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHP 35 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 43 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 30 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 60 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 99 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 129 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 48 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 156 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 143 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 173 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHP 156 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 33 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 63 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 177 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 207 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 164 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 194 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHP 177 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 68 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 45 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 32 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 62 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 71 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 58 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 88 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 84 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 71 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 101 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 237 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 267 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 224 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 254 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHP 237 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 57 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 44 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 74 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 72 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 102 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 59 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 89 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 51 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 99 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 129 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 86 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 116 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHP 99 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 33 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 63 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 68 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 124 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 154 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 111 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 141 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 719 NSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 N+R G P LAVVLQRRDWE + L L P Sbjct: 82 NARAGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 84 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 114 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 52 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 82 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 39 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 69 Score = 29.9 bits (64), Expect = 5.9 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 722 SRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 SR G P LAVVLQRRDWE + L L P Sbjct: 11 SRNGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 170 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 157 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 187 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 113 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 70 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 100 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 99 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 129 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 124 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 154 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 111 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 141 Score = 30.7 bits (66), Expect = 3.4 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +2 Query: 725 RGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 RGG P LAVVLQRRDWE + L L P Sbjct: 84 RGGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 1214 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 45.6 bits (103), Expect = 1e-04 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 928 HSPFRLRNCWXGDRCGPXWLLRQLAKGG 845 HSPFRLRNCW G LLRQLAKGG Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGG 431 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 1201 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 1231 Score = 30.3 bits (65), Expect = 4.5 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 722 SRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 S+G P LAVVLQRRDWE + L L P Sbjct: 1172 SQGKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 1214 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 56 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 43 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 73 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 149 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 179 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 136 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 166 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHP 149 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 101 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 88 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 118 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHP 101 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 55 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 42 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 72 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 45 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 47 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 120 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 150 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 107 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 137 Score = 30.7 bits (66), Expect = 3.4 Identities = 22/65 (33%), Positives = 24/65 (36%) Frame = +2 Query: 656 NLTCKFRHYFTXXXXXXXXXXNSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIA 835 +LT RH NS G P LAVVLQRRDWE + L Sbjct: 57 SLTNTTRHNSLPNTTRHNSLHNSTRGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNR 115 Query: 836 LQXSP 850 L P Sbjct: 116 LAAHP 120 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 85 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 72 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 102 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 108 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 138 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 95 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 64 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 51 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 108 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 138 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 95 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 108 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 138 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 95 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 45 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 32 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 62 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 119 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 76 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 48 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 35 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 65 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 132 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 162 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 119 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 149 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 48 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 35 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 65 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 67 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 54 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 100 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 130 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 87 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 117 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHP 100 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 91 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 121 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 78 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 108 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 115 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 145 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 102 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 132 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHP 115 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 65 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 52 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 82 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 1087 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1117 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 1074 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 1104 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHP 1087 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 28 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 58 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 55 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 42 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 72 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 158 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 188 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 145 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 175 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 206 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 236 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 193 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 223 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHP 206 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 194 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 224 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 181 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 211 Score = 30.3 bits (65), Expect = 4.5 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQX-SPFR--QLA**PXRPAPIAXPTVAQPEWRMANCXRX 946 LAVVLQRRDWE + L L PF + + P EWR+ C + Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDKS 229 Query: 947 FLXK 958 F+ + Sbjct: 230 FIFR 233 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 83 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 113 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 70 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 100 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 59 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 89 Score = 36.3 bits (80), Expect = 0.068 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = +1 Query: 775 TGRRFTTS*LGNPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 TGRR NPGVTQLNR A P + ++ ARTDR S Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 76 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 43 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 30 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 60 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 170 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 157 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 187 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 69 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 140 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 170 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 127 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 157 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHP 140 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 47 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 77 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 34 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 64 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHP 47 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 676 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 706 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 663 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 693 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHP 676 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 63 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 93 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 50 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 185 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 215 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 172 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 202 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 71 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 58 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 88 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 56 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 43 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 73 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 33 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 63 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 69 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 94 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 124 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 81 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 111 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 28 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 58 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 84 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 43.2 bits (97), Expect = 6e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGE 926 PPFASWRNS+ P QQLRSLNGE Sbjct: 19 PPFASWRNSEEARTDRPSQQLRSLNGE 45 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 71 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 101 Score = 29.9 bits (64), Expect = 5.9 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 Query: 719 NSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 N G P+ + LAVVLQRRDWE + L L P Sbjct: 43 NGEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 95 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 125 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 82 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 112 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 103 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 133 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 90 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 120 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 209 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 239 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 196 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 226 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 468 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 498 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 455 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 485 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHP 468 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 84 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 114 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 290 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 320 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 277 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 307 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHP 290 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 31 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 45 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 85 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 72 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 102 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 94 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 124 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 81 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 111 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 128 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 158 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 115 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 145 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 87 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 117 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 74 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 104 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 84 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 114 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 84 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 114 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 28 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 58 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 49 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 Score = 36.3 bits (80), Expect = 0.068 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = +1 Query: 775 TGRRFTTS*LGNPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 TGRR NPGVTQLNR A P + ++ ARTDR S Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 66 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 98 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 128 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 85 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 115 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHP 98 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 69 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 99 Score = 36.3 bits (80), Expect = 0.068 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = +1 Query: 775 TGRRFTTS*LGNPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 TGRR NPGVTQLNR A P + ++ ARTDR S Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 86 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 107 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 137 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 94 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 124 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 200 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 230 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 187 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 217 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHP 200 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 55 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 42 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 72 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 107 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 137 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 94 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 124 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 31 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 103 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 60 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 30.7 bits (66), Expect = 3.4 Identities = 20/60 (33%), Positives = 23/60 (38%) Frame = +2 Query: 671 FRHYFTXXXXXXXXXXNSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 FRH + + GG P LAVVLQRRDWE + L L P Sbjct: 15 FRHECSQDAMYGRLRQSGVGGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 97 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 84 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 114 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 166 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 196 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 153 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 183 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHP 166 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 92 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 122 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 79 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 109 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 68 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 123 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 80 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 110 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 31 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 92 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 49 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 68 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 55 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 85 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 73 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 103 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 105 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 135 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 92 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 122 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 215 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 245 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 202 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 232 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHP 215 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 111 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 141 Score = 33.9 bits (74), Expect = 0.36 Identities = 20/66 (30%), Positives = 26/66 (39%) Frame = +2 Query: 653 PNLTCKFRHYFTXXXXXXXXXXNSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLI 832 P+ + + H FT G P+ + LAVVLQRRDWE + L Sbjct: 48 PSDSSEHNHDFTFESATALSESGQHGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLN 105 Query: 833 ALQXSP 850 L P Sbjct: 106 RLAAHP 111 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 98 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 128 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 128 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 158 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 115 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 145 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 62 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 92 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 49 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 74 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 104 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 61 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 73 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 103 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 60 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 65 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 52 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 82 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 46 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 33 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 63 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 31 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 150 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 180 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 137 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 167 Score = 29.9 bits (64), Expect = 5.9 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 719 NSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 NS+ P LAVVLQRRDWE + L L P Sbjct: 107 NSQPDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 67 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 54 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 123 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 80 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 110 Score = 29.9 bits (64), Expect = 5.9 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 719 NSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 + RG P+ + LAVVLQRRDWE + L L P Sbjct: 52 DQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 66 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 96 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 29 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 59 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 78 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 108 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 65 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 95 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 112 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 99 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 129 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 66 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 96 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 69 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 44 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 31 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 118 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 148 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 105 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 135 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHP 118 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 89 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 119 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 76 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 191 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 221 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 178 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 208 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHP 191 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 86 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 73 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 103 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 66 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 96 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 53 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 83 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 41 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 28 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 58 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 57 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 44 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 74 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 103 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 133 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 90 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 120 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 81 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 68 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 45 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 129 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 159 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 116 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 146 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHP 129 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 70 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 100 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 57 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 87 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 60 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 47 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 143 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 173 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 130 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 160 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 176 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 206 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 163 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 193 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHP 176 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 126 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 156 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 113 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 143 Score = 29.9 bits (64), Expect = 5.9 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +2 Query: 722 SRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 ++GG P LAVVLQRRDWE + L L P Sbjct: 85 AKGGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 126 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 58 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 45 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 50 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 37 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 67 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 119 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 149 Score = 30.3 bits (65), Expect = 4.5 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHP 119 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 66 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 96 Score = 30.3 bits (65), Expect = 4.5 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 719 NSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 +SR G P LAVVLQRRDWE + L L P Sbjct: 37 SSRSGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 61 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 48 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 67 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 97 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 180 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 210 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 167 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 197 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHP 180 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 51 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 38 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 68 Score = 29.9 bits (64), Expect = 5.9 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = +2 Query: 725 RGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 +GG V + LAVVLQRRDWE + L L P Sbjct: 11 KGGQV-SESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 51 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 123 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 80 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 110 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 150 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 180 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 137 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 167 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 82 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 69 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 113 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 143 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 100 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 130 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHP 113 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 42 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 29 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 59 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 50 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 37 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 67 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 109 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 139 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 96 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 126 Score = 29.9 bits (64), Expect = 5.9 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +2 Query: 722 SRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 +RG P+ + LAVVLQRRDWE + L L P Sbjct: 69 TRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 68 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 55 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 85 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 117 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 147 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 104 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 134 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 169 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 199 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 156 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 186 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHP 169 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 96 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 126 Score = 36.3 bits (80), Expect = 0.068 Identities = 21/42 (50%), Positives = 24/42 (57%) Frame = +1 Query: 775 TGRRFTTS*LGNPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 TGRR NPGVTQLNR A P + ++ ARTDR S Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 113 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 815 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 845 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 802 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 832 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 737 VPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 VP+ LAVVLQRRDWE + L L P Sbjct: 778 VPSESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 815 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 96 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 126 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 83 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 113 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHP 96 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 117 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 147 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 104 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 134 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 79 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 66 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 96 Score = 30.3 bits (65), Expect = 4.5 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +2 Query: 719 NSRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 ++RG P+ + LAVVLQRRDWE + L L P Sbjct: 38 SNRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 131 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 161 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 118 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 148 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 105 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 135 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 92 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 122 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 132 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 162 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 119 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 149 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 330 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 360 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 317 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 347 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHP 330 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 54 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 84 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 41 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 71 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHP 54 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 76 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 106 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 63 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 93 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHP 76 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 39 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 26 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 56 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHP 39 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 50 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 37 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 67 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 77 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 107 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 64 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 94 Score = 29.9 bits (64), Expect = 5.9 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +2 Query: 722 SRGGPVPNXXXXXXXXXXLAVVLQRRDWETLALPNLIALQXSP 850 ++GG P LAVVLQRRDWE + L L P Sbjct: 36 AKGGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 77 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 40 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 27 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 49.2 bits (112), Expect = 9e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 846 PPFASWRNSQXGPHRSPFQQLRSLNGEWQIV 938 PPFASWRNS+ P QQLRSLNGEW+++ Sbjct: 80 PPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 808 NPGVTQLNRXAXIPLSPAGVIAKXARTDRXS 900 NPGVTQLNR A P + ++ ARTDR S Sbjct: 67 NPGVTQLNRLAAHPPFASWRNSEEARTDRPS 97 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 776 LAVVLQRRDWETLALPNLIALQXSP 850 LAVVLQRRDWE + L L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,446,756 Number of Sequences: 59808 Number of extensions: 725013 Number of successful extensions: 11448 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11294 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5199835211 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -