BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H03_e600_15.seq (1526 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 24 3.4 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 6.0 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.8 bits (49), Expect = 3.4 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +1 Query: 424 PSVTSRKTIFGTGSEWWLLHMTHMSFATSTSMLIATMKTT 543 P+ T ++T + W+L H T+T L +TT Sbjct: 220 PTFTQQQTQYSQYGSWFLPHQPIYPAVTATVQLSTCTRTT 259 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.0 bits (47), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 573 NYFIYKQLNPRCLHCRYQ 520 N I K+ RC +CRYQ Sbjct: 127 NCIIDKRQRNRCQYCRYQ 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,929 Number of Sequences: 336 Number of extensions: 4247 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45886400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -