BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H03_e600_15.seq (1526 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 6e-21 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 98 1e-20 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 95 1e-19 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 95 2e-19 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 2e-17 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 82 1e-15 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 1e-14 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 1e-14 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 2e-14 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 3e-14 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 9e-14 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 2e-13 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 73 8e-13 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 73 8e-13 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 73 8e-13 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 57 3e-08 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 56 6e-08 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 55 2e-07 SB_5886| Best HMM Match : DUF1205 (HMM E-Value=5.9) 53 7e-07 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-06 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 51 3e-06 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-06 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 50 4e-06 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-06 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 50 7e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 50 7e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 50 7e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 50 7e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 50 7e-06 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 50 7e-06 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 50 7e-06 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 50 7e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 50 7e-06 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 50 7e-06 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 50 7e-06 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 50 7e-06 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 50 7e-06 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 50 7e-06 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 50 7e-06 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 50 7e-06 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 50 7e-06 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 50 7e-06 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 50 7e-06 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 50 7e-06 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 50 7e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 50 7e-06 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 50 7e-06 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 50 7e-06 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 50 7e-06 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 50 7e-06 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 50 7e-06 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 50 7e-06 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 50 7e-06 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 50 7e-06 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 50 7e-06 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 50 7e-06 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 50 7e-06 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 50 7e-06 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 50 7e-06 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 50 7e-06 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 50 7e-06 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 50 7e-06 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 50 7e-06 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 50 7e-06 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 50 7e-06 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 50 7e-06 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 50 7e-06 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 50 7e-06 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 50 7e-06 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 50 7e-06 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 50 7e-06 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 50 7e-06 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 50 7e-06 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 50 7e-06 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 50 7e-06 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 50 7e-06 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 50 7e-06 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 50 7e-06 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 50 7e-06 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 50 7e-06 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 50 7e-06 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 50 7e-06 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 50 7e-06 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 47 3e-05 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 47 3e-05 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 47 5e-05 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 47 5e-05 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 47 5e-05 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 47 5e-05 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 47 5e-05 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 47 5e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 47 5e-05 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 47 5e-05 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 47 5e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 47 5e-05 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 47 5e-05 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 47 5e-05 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 47 5e-05 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 47 5e-05 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 47 5e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 47 5e-05 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 47 5e-05 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 47 5e-05 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 47 5e-05 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 47 5e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 47 5e-05 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 47 5e-05 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 47 5e-05 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 47 5e-05 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 47 5e-05 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 100 bits (239), Expect = 4e-21 Identities = 44/55 (80%), Positives = 46/55 (83%) Frame = -3 Query: 783 VGRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRANW 619 +GRAIGAGLFAI +RGMCC A KLGNA FPSHD VKRRPVNCNTTHYRANW Sbjct: 13 LGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 99.5 bits (237), Expect = 6e-21 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = -3 Query: 789 ATVGRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRANW 619 ATVG+ GLFAI +RGMCC A KLGNA+GFPSHD VKRRPVNCNTTHYRANW Sbjct: 3 ATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 98.3 bits (234), Expect = 1e-20 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = -3 Query: 783 VGRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRAN 622 +GR+IGAGLFAI +RGMCC A KLGNARGFPSHD KRRPVNCNTTHYRAN Sbjct: 44 LGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 95.5 bits (227), Expect = 1e-19 Identities = 42/52 (80%), Positives = 43/52 (82%) Frame = -3 Query: 774 AIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRANW 619 AIGAGLFAI +RGMCC A KLGNA FPSHD VKRRPVNCNTTHYRANW Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 94.7 bits (225), Expect = 2e-19 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = -3 Query: 783 VGRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRANW 619 +GRAIGAGLFAI +RGMCC + KL +A FPSHD VKRRPVNCNTTHYRANW Sbjct: 7 LGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 88.2 bits (209), Expect = 2e-17 Identities = 41/55 (74%), Positives = 43/55 (78%) Frame = -3 Query: 783 VGRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRANW 619 +GRAIGAGLFAI +RGMCC A KL FPSHD VKRRPVNCNTTHYRANW Sbjct: 1846 LGRAIGAGLFAITPAGERGMCCKAIKLVTPV-FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 83.4 bits (197), Expect = 4e-16 Identities = 38/56 (67%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -3 Query: 783 VGRAIGAGLFAIRQLAKRGMCCXAN-KLGNARGFPSHDXVKRRPVNCNTTHYRANW 619 +GRAIGAGLFAI ++G + KLG +GFPSHD VKRRPVNCNTTHYRANW Sbjct: 47 LGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 82.2 bits (194), Expect = 1e-15 Identities = 50/94 (53%), Positives = 53/94 (56%), Gaps = 6/94 (6%) Frame = +1 Query: 538 TTRIKL---FINKIVLHXXXXXXTRGGARYPIRPIVSRITIHWPSFYXVVTGKTPGVTQL 708 T RIKL F+ T GGA PIRPIVSRITIHWP+FY TGKT TQL Sbjct: 11 TDRIKLDIEFLQPGGSSCSRAAATDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQL 68 Query: 709 IRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 RLAAH PF S+ AR DRPS S EW Sbjct: 69 NRLAAHPPFASWRNSQEARADRPSQQLRSLNGEW 102 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.8 bits (193), Expect = 1e-15 Identities = 41/58 (70%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGK PGVTQL RLAAH PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 78.6 bits (185), Expect = 1e-14 Identities = 40/58 (68%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGK GVTQL RLAAH PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 78.6 bits (185), Expect = 1e-14 Identities = 40/58 (68%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGK GVTQL RLAAH PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 77.8 bits (183), Expect = 2e-14 Identities = 39/58 (67%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY V+ KTPGVTQL RLAAH PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 59 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 77.4 bits (182), Expect = 3e-14 Identities = 40/58 (68%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGKT VTQL RLAAH PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 75.8 bits (178), Expect = 9e-14 Identities = 37/53 (69%), Positives = 38/53 (71%) Frame = +1 Query: 622 IRPIVSRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS 780 IRPIVSRITIHWPSFY + PGV QL RLAAH PF SE ARTDRPS Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPS 70 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 74.9 bits (176), Expect = 2e-13 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 741 LAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRAN 622 LA+RGMCC A KLGNA F SHD VKRRPVNCNTTHYRAN Sbjct: 1 LAERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.1 bits (174), Expect = 3e-13 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VV + PGVTQL RLAAH PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 73.7 bits (173), Expect = 3e-13 Identities = 37/55 (67%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Frame = +1 Query: 652 HWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 HWPSFY VVTGKT GVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 59 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 72.5 bits (170), Expect = 8e-13 Identities = 39/65 (60%), Positives = 44/65 (67%), Gaps = 2/65 (3%) Frame = -3 Query: 807 HSPFXXATV--GRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTH 634 HSPF GR++ A +RQLAK G C A +L + GFPSHD VKRRPVNCNTTH Sbjct: 589 HSPFRLRNCWEGRSVRASSL-LRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTH 643 Query: 633 YRANW 619 YRANW Sbjct: 644 YRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 72.5 bits (170), Expect = 8e-13 Identities = 39/65 (60%), Positives = 44/65 (67%), Gaps = 2/65 (3%) Frame = -3 Query: 807 HSPFXXATV--GRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTH 634 HSPF GR++ A +RQLAK G C A +L + GFPSHD VKRRPVNCNTTH Sbjct: 32 HSPFRLRNCWEGRSVRASSL-LRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTH 86 Query: 633 YRANW 619 YRANW Sbjct: 87 YRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 72.5 bits (170), Expect = 8e-13 Identities = 39/65 (60%), Positives = 44/65 (67%), Gaps = 2/65 (3%) Frame = -3 Query: 807 HSPFXXATV--GRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTH 634 HSPF GR++ A +RQLAK G C A +L + GFPSHD VKRRPVNCNTTH Sbjct: 32 HSPFRLRNCWEGRSVRASSL-LRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTH 86 Query: 633 YRANW 619 YRANW Sbjct: 87 YRANW 91 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 72.1 bits (169), Expect = 1e-12 Identities = 37/58 (63%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGKT + LI LAAH PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.9 bits (161), Expect = 1e-11 Identities = 35/55 (63%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -3 Query: 780 GRAIGAGLFAIRQLAKRGMCCXANKLGNAR-GFPSHDXVKRRPVNCNTTHYRANW 619 GR++ A +RQLAK G C A +L GFPSHD VKRRPVNCNTTHYRANW Sbjct: 29 GRSVRASSL-LRQLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 39.9 bits (89), Expect = 0.005 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 779 EGRSVRAXSLYASWRKGECAARRISW 702 EGRSVRA SL KG CAARR+SW Sbjct: 28 EGRSVRASSLLRQLAKGGCAARRLSW 53 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 2e-11 Identities = 35/58 (60%), Positives = 36/58 (62%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGKT + LI L H PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 63.3 bits (147), Expect = 5e-10 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = +1 Query: 634 VSRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 +SRITIHWPS + PGVTQL RLAAH PF SE ARTDRPS S EW Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 335 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 63.3 bits (147), Expect = 5e-10 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGKT + LI L PF SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 61.7 bits (143), Expect = 2e-09 Identities = 35/64 (54%), Positives = 39/64 (60%), Gaps = 4/64 (6%) Frame = +1 Query: 622 IRPIVSRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQL-AYSEXARTDRPS---NSC 789 +RP+VSRITIHW SFY VVTGKT + LI L H P +E ARTDRPS S Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAEEARTDRPSQQLRSL 91 Query: 790 XXEW 801 EW Sbjct: 92 NGEW 95 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 60.5 bits (140), Expect = 3e-09 Identities = 28/55 (50%), Positives = 33/55 (60%) Frame = -3 Query: 783 VGRAIGAGLFAIRQLAKRGMCCXANKLGNARGFPSHDXVKRRPVNCNTTHYRANW 619 + R A + A + M +N +A FPSHD VKRRPVNCNTTHYRANW Sbjct: 5 IPRETVAVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.5 bits (140), Expect = 3e-09 Identities = 32/48 (66%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Frame = +1 Query: 667 YXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 Y VVTGKTPGVTQL RLAAH PF SE ARTDRPS S EW Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 59.7 bits (138), Expect = 6e-09 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 690 GFPSHDXVKRRPVNCNTTHYRANW 619 GFPSHD VKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 59.7 bits (138), Expect = 6e-09 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 690 GFPSHDXVKRRPVNCNTTHYRANW 619 GFPSHD VKRRPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 59.7 bits (138), Expect = 6e-09 Identities = 34/62 (54%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = +1 Query: 628 PIVSRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLA-YSEXARTDRPS---NSCXX 795 P +SRITIHWPSFY VVTGKT + LI L H P + E ARTDRPS S Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGLHREEARTDRPSQQLRSLNG 135 Query: 796 EW 801 EW Sbjct: 136 EW 137 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 59.7 bits (138), Expect = 6e-09 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -2 Query: 778 KGDRCGPXRYTPAGEKGNVLXGE*VG*RQGFSQSRRCKTTASEL 647 KGDRCGP RY + KG+VL G GFSQSRRCKTTASEL Sbjct: 7 KGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 57.6 bits (133), Expect = 2e-08 Identities = 34/59 (57%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAY-SEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGKT + LI L H P SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 57.2 bits (132), Expect = 3e-08 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = -2 Query: 778 KGDRCGPXRYTPAGEKGNVLXGE*VG*RQGFSQSRRCKTTASEL 647 KGDRCGP RY + KG+ G GFSQSRRCKTTASEL Sbjct: 36 KGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 57.2 bits (132), Expect = 3e-08 Identities = 29/43 (67%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +2 Query: 683 GKPLALPNLFAXQHIPLFASWRIAXRPAPIALP-TVAXLNGEW 808 GK LALPNL A QHIPL + IA RPAPIALP + LNGEW Sbjct: 17 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSP 732 SRITIHWPSFY VVTGKT + LI L H P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIP 32 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 4e-08 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGKT + L L + SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 56.4 bits (130), Expect = 6e-08 Identities = 38/71 (53%), Positives = 38/71 (53%), Gaps = 3/71 (4%) Frame = +1 Query: 598 TRGGARYPIRPIVSRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRP 777 T GGA PIRPIVS ITIHWPSFY VT AH PF SE ARTDRP Sbjct: 36 TVGGA--PIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRNSEEARTDRP 80 Query: 778 S---NSCXXEW 801 S S EW Sbjct: 81 SQQLRSLNGEW 91 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 56.4 bits (130), Expect = 6e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -2 Query: 778 KGDRCGPXRYTPAGEKGNVLXGE*VG*RQGFSQSRRCKTTASEL 647 KGDRCGP RY + KG+VL GFSQSRRCKTTASEL Sbjct: 7 KGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 54.8 bits (126), Expect = 2e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 783 VGRAIGAGLFAIRQLAKRGMCCXANKLGNARGFP 682 +GRAIGAGLFAI +RGMCC A KLGNAR FP Sbjct: 20 LGRAIGAGLFAITPAGERGMCCKAIKLGNARVFP 53 >SB_5886| Best HMM Match : DUF1205 (HMM E-Value=5.9) Length = 85 Score = 52.8 bits (121), Expect = 7e-07 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +2 Query: 686 KPLALPNLFAXQHIPLFASWRIAXRPAPIALPT-VAXLNGEW 808 K LALPNL A QH+PL + I RPAPIALP + LNGEW Sbjct: 4 KTLALPNLIALQHVPLSPAGVIPKRPAPIALPNMLRSLNGEW 45 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 52.0 bits (119), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 650 FTGRRFTXS*LGKPLALPNLFAXQHIPLFASWR 748 +TGRRFT GK LALPNL A QHIP FASWR Sbjct: 54 WTGRRFTTLVTGKTLALPNLIALQHIPHFASWR 86 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 51.6 bits (118), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPSNSC 789 + PGVTQL RLAAH PF SE ARTDRPS+SC Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSC 98 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 54 LAVVLQRRDWENP 66 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 51.2 bits (117), Expect = 2e-06 Identities = 30/56 (53%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = +1 Query: 652 HWPSFYXVVTGKTPGVTQLIRLAAHSPFRQLA-YSEXARTDRPS---NSCXXEWRM 807 HWPSFY VVTGKT + LI L H P SE ARTDRPS S EWR+ Sbjct: 5 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRL 59 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 50.8 bits (116), Expect = 3e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 655 WPSFYXVVTGKTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 WPS Y GVTQL RL AH PF SE ARTDRPS S EWR+ Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSWRNSEEARTDRPSQQMRSLNGEWRL 271 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -2 Query: 778 KGDRCGPXRYTPAGEKGNVLXGE*VG*RQGFSQSRRCKTTASEL 647 +GDRCGP RY + KG GFSQSRRCKTTASEL Sbjct: 67 QGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 Score = 37.9 bits (84), Expect = 0.021 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 749 YASWRKGECAARRISW 702 YASWRKG CAARR+SW Sbjct: 77 YASWRKGGCAARRLSW 92 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 50.4 bits (115), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 678 HDXVKRRPVNCNTTHYRANW 619 HD VKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 50.4 bits (115), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 678 HDXVKRRPVNCNTTHYRANW 619 HD VKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 50.4 bits (115), Expect = 4e-06 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +1 Query: 637 SRITIHWPSFYXVVTGKTPGVTQLIRLAAHSPF-RQLAYSEXARTDRPS---NSCXXEW 801 SRITIHWPSFY VVTGK G + + P SE ARTDRPS S EW Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNGEW 60 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 50.0 bits (114), Expect = 5e-06 Identities = 27/52 (51%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRMAIVSVKFL 831 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ F+ Sbjct: 180 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDKSFI 231 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 170 LAVVLQRRDWENP 182 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 25 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 62 LAVVLQRRDWENP 74 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 35 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 25 LAVVLQRRDWENP 37 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 49 LAVVLQRRDWENP 61 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 28 LAVVLQRRDWENP 40 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 18 LAVVLQRRDWENP 30 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 843 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 600 SRGGPVXXXXXXXXXXXXLAVVLXRRDWENP 692 SRG P+ LAVVL RRDWENP Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENP 845 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 124 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 114 LAVVLQRRDWENP 126 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 39 LAVVLQRRDWENP 51 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 20 LAVVLQRRDWENP 32 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 21 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 11 LAVVLQRRDWENP 23 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 29 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 19 LAVVLQRRDWENP 31 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 88 LAVVLQRRDWENP 100 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 37 LAVVLQRRDWENP 49 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 142 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 132 LAVVLQRRDWENP 144 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 22 LAVVLQRRDWENP 34 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 163 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 153 LAVVLQRRDWENP 165 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 57 LAVVLQRRDWENP 69 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 21 LAVVLQRRDWENP 33 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 60 LAVVLQRRDWENP 72 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 223 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 213 LAVVLQRRDWENP 225 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 43 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 33 LAVVLQRRDWENP 45 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 58 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 48 LAVVLQRRDWENP 60 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 40 LAVVLQRRDWENP 52 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 85 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 75 LAVVLQRRDWENP 87 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 22 LAVVLQRRDWENP 34 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 57 LAVVLQRRDWENP 69 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 100 LAVVLQRRDWENP 112 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 73 LAVVLQRRDWENP 85 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 28 LAVVLQRRDWENP 40 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 156 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 146 LAVVLQRRDWENP 158 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 59 LAVVLQRRDWENP 71 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 88 LAVVLQRRDWENP 100 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 100 LAVVLQRRDWENP 112 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 1200 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 39.9 bits (89), Expect = 0.005 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 779 EGRSVRAXSLYASWRKGECAARRISW 702 EGRSVRA SL KG CAARR+SW Sbjct: 414 EGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 1190 LAVVLQRRDWENP 1202 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 32 LAVVLQRRDWENP 44 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 135 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 125 LAVVLQRRDWENP 137 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 87 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 77 LAVVLQRRDWENP 89 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 41 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 31 LAVVLQRRDWENP 43 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 36 LAVVLQRRDWENP 48 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 106 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 Score = 30.3 bits (65), Expect = 4.3 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 597 NSRGGPVXXXXXXXXXXXXLAVVLXRRDWENP 692 ++RG P+ LAVVL RRDWENP Sbjct: 79 STRGDPLESTCRHASLA--LAVVLQRRDWENP 108 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 71 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 61 LAVVLQRRDWENP 73 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 84 LAVVLQRRDWENP 96 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 40 LAVVLQRRDWENP 52 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 84 LAVVLQRRDWENP 96 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 84 LAVVLQRRDWENP 96 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 21 LAVVLQRRDWENP 33 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 65 LAVVLQRRDWENP 77 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 34 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 24 LAVVLQRRDWENP 36 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 118 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 108 LAVVLQRRDWENP 120 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 34 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 24 LAVVLQRRDWENP 36 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 43 LAVVLQRRDWENP 55 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 86 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 76 LAVVLQRRDWENP 88 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 67 LAVVLQRRDWENP 79 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 91 LAVVLQRRDWENP 103 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 41 LAVVLQRRDWENP 53 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 1073 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 1063 LAVVLQRRDWENP 1075 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 17 LAVVLQRRDWENP 29 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 41 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 31 LAVVLQRRDWENP 43 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 144 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 134 LAVVLQRRDWENP 146 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 192 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 182 LAVVLQRRDWENP 194 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 59 LAVVLQRRDWENP 71 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 29 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 19 LAVVLQRRDWENP 31 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 156 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 146 LAVVLQRRDWENP 158 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 58 LAVVLQRRDWENP 70 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 126 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 116 LAVVLQRRDWENP 128 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 33 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 23 LAVVLQRRDWENP 35 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 662 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 652 LAVVLQRRDWENP 664 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 39 LAVVLQRRDWENP 51 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 171 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 161 LAVVLQRRDWENP 173 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 47 LAVVLQRRDWENP 59 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 32 LAVVLQRRDWENP 44 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 22 LAVVLQRRDWENP 34 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 58 LAVVLQRRDWENP 70 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 70 LAVVLQRRDWENP 82 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 17 LAVVLQRRDWENP 29 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 712 RLAAHSPFRQLAYSEXARTDRPS 780 +++AH PF SE ARTDRPS Sbjct: 14 QVSAHPPFASWRNSEEARTDRPS 36 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 60 LAVVLQRRDWENP 72 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 81 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 71 LAVVLQRRDWENP 83 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 89 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 79 LAVVLQRRDWENP 91 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 195 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 185 LAVVLQRRDWENP 197 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 454 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 444 LAVVLQRRDWENP 456 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 73 LAVVLQRRDWENP 85 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 276 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 266 LAVVLQRRDWENP 278 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 20 LAVVLQRRDWENP 32 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 71 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 61 LAVVLQRRDWENP 73 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 70 LAVVLQRRDWENP 82 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 114 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 104 LAVVLQRRDWENP 116 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 73 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 63 LAVVLQRRDWENP 75 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 73 LAVVLQRRDWENP 85 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 73 LAVVLQRRDWENP 85 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 17 LAVVLQRRDWENP 29 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 35 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 84 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 74 LAVVLQRRDWENP 86 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 55 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 93 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 83 LAVVLQRRDWENP 95 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 186 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 176 LAVVLQRRDWENP 188 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 41 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 31 LAVVLQRRDWENP 43 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 93 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 83 LAVVLQRRDWENP 95 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 20 LAVVLQRRDWENP 32 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 49 LAVVLQRRDWENP 61 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 73 LAVVLQRRDWENP 85 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 152 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 142 LAVVLQRRDWENP 154 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 78 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 68 LAVVLQRRDWENP 80 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 57 LAVVLQRRDWENP 69 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 69 LAVVLQRRDWENP 81 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 20 LAVVLQRRDWENP 32 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 38 LAVVLQRRDWENP 50 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 44 LAVVLQRRDWENP 56 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 62 LAVVLQRRDWENP 74 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 91 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 81 LAVVLQRRDWENP 93 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 201 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 244 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 191 LAVVLQRRDWENP 203 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 97 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 87 LAVVLQRRDWENP 99 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 114 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 104 LAVVLQRRDWENP 116 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 38 LAVVLQRRDWENP 50 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 50 LAVVLQRRDWENP 62 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 49 LAVVLQRRDWENP 61 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 41 LAVVLQRRDWENP 53 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 22 LAVVLQRRDWENP 34 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 20 LAVVLQRRDWENP 32 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 136 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 126 LAVVLQRRDWENP 138 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 43 LAVVLQRRDWENP 55 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 69 LAVVLQRRDWENP 81 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 55 LAVVLQRRDWENP 67 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 18 LAVVLQRRDWENP 30 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 54 LAVVLQRRDWENP 66 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 88 LAVVLQRRDWENP 100 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 55 LAVVLQRRDWENP 67 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 58 LAVVLQRRDWENP 70 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPSNSC 789 + PGVTQL RLAAH PF SE ARTDRPS C Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQC 73 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 29 LAVVLQRRDWENP 41 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 20 LAVVLQRRDWENP 32 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 104 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 94 LAVVLQRRDWENP 106 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 65 LAVVLQRRDWENP 77 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 177 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 167 LAVVLQRRDWENP 179 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 62 LAVVLQRRDWENP 74 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 52 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 42 LAVVLQRRDWENP 54 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 17 LAVVLQRRDWENP 29 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 43 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 33 LAVVLQRRDWENP 45 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 89 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 79 LAVVLQRRDWENP 91 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 57 LAVVLQRRDWENP 69 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 115 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 105 LAVVLQRRDWENP 117 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 46 LAVVLQRRDWENP 58 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 36 LAVVLQRRDWENP 48 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 129 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 119 LAVVLQRRDWENP 131 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 162 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 152 LAVVLQRRDWENP 164 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 112 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 102 LAVVLQRRDWENP 114 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 36 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 26 LAVVLQRRDWENP 38 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 55 LAVVLQRRDWENP 67 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 37 LAVVLQRRDWENP 49 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 56 LAVVLQRRDWENP 68 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 166 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 156 LAVVLQRRDWENP 168 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 37 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 27 LAVVLQRRDWENP 39 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 69 LAVVLQRRDWENP 81 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 136 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 126 LAVVLQRRDWENP 138 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 58 LAVVLQRRDWENP 70 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 99 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 89 LAVVLQRRDWENP 101 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 49.6 bits (113), Expect = 7e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPSNSC 789 + PGVTQL RLAAH PF SE ARTDRPS C Sbjct: 522 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQC 556 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 512 LAVVLQRRDWENP 524 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 18 LAVVLQRRDWENP 30 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 36 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 26 LAVVLQRRDWENP 38 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 81 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 71 LAVVLQRRDWENP 83 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 95 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 85 LAVVLQRRDWENP 97 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 44 LAVVLQRRDWENP 56 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 103 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 30.7 bits (66), Expect = 3.2 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 567 NSFTLXXXXXNSRGGPVXXXXXXXXXXXXLAVVLXRRDWENP 692 ++F L ++ G P+ LAVVL RRDWENP Sbjct: 66 HAFPLPFSSTHTPGDPLESTCRHASLA--LAVVLQRRDWENP 105 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 155 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 145 LAVVLQRRDWENP 157 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 82 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 801 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 791 LAVVLQRRDWENP 803 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 82 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 72 LAVVLQRRDWENP 84 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 103 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 93 LAVVLQRRDWENP 105 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 30.3 bits (65), Expect = 4.3 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 597 NSRGGPVXXXXXXXXXXXXLAVVLXRRDWENP 692 ++RG P+ LAVVL RRDWENP Sbjct: 38 SNRGDPLESTCRHASLA--LAVVLQRRDWENP 67 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 117 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 107 LAVVLQRRDWENP 119 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 91 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 81 LAVVLQRRDWENP 93 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 118 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 108 LAVVLQRRDWENP 120 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 316 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 306 LAVVLQRRDWENP 318 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 40 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 30 LAVVLQRRDWENP 42 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 62 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 52 LAVVLQRRDWENP 64 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 25 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 15 LAVVLQRRDWENP 27 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 36 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 26 LAVVLQRRDWENP 38 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 106 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 53 LAVVLQRRDWENP 65 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 49.6 bits (113), Expect = 7e-06 Identities = 33/72 (45%), Positives = 37/72 (51%), Gaps = 7/72 (9%) Frame = +1 Query: 607 GARYPIRPIVSRITIHWPSFYXVVTGK----TPGVTQLIRLAAHSPFRQLAYSEXARTDR 774 G YP P SR + + + VV + PGVTQL RLAAH PF SE ARTDR Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 101 Query: 775 PS---NSCXXEW 801 PS S EW Sbjct: 102 PSQQLRSLNGEW 113 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 16 LAVVLQRRDWENP 28 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 56 LAVVLQRRDWENP 68 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 257 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 247 LAVVLQRRDWENP 259 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 91 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 81 LAVVLQRRDWENP 93 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 34 LAVVLQRRDWENP 46 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +1 Query: 685 KTPGVTQLIRLAAHSPFRQLAYSEXARTDRPS---NSCXXEWRM 807 + PGVTQL RLAAH PF SE ARTDRPS S EWR+ Sbjct: 58 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 654 LAVVLXRRDWENP 692 LAVVL RRDWENP Sbjct: 48 LAVVLQRRDWENP 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,141,714 Number of Sequences: 59808 Number of extensions: 585883 Number of successful extensions: 8163 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8112 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4965079671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -