BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H03_e600_15.seq (1526 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal prote... 81 2e-15 >U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal protein, large subunitprotein 22, isoform a protein. Length = 130 Score = 81.4 bits (192), Expect = 2e-15 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 1/99 (1%) Frame = +3 Query: 216 ISLKFTIDCTHPAEDSILDVGNFEKYLKERVKVEGKTNNL-GNHVVIARDKTKVAINADI 392 + LKF ++C +P ED IL + + E +L E++KV GKT +L N+V + K+KV++ +++ Sbjct: 19 VHLKFNVECKNPVEDGILRIEDLEAFLNEKIKVNGKTGHLAANNVKVEVAKSKVSVVSEV 78 Query: 393 PFSXXXXXXXXXXXXXXXXXXDWLRVVASAHDSYELRYF 509 PFS DWLRVVA ++YE+RYF Sbjct: 79 PFSKRYLKYLTKKYLKRNSLRDWLRVVAVNKNTYEVRYF 117 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,791,167 Number of Sequences: 27780 Number of extensions: 425116 Number of successful extensions: 807 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4390273854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -