BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H02_e592_16.seq (1499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0596 - 26497863-26497913,26498010-26498081,26499015-264990... 33 0.58 09_04_0512 + 18226981-18227143,18227648-18229555,18229649-182302... 31 1.8 09_04_0087 + 14476539-14476675,14478876-14479635,14479720-144798... 31 1.8 05_07_0247 + 28643862-28644310,28645151-28645207,28645644-286489... 31 1.8 04_03_0937 + 20923705-20923833,20924001-20924012,20924413-209244... 31 2.4 11_06_0152 + 20669949-20670326,20670887-20670997,20671079-206712... 30 4.1 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 30 4.1 05_04_0140 - 18358997-18359082,18359255-18359318,18359469-183595... 30 4.1 12_01_0079 + 644754-645932,645966-646061,646193-647122 30 5.4 11_01_0078 + 609005-610183,610217-610312,610444-611373 30 5.4 08_02_0902 - 22408895-22409620,22410190-22410326,22410550-224106... 30 5.4 05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28... 30 5.4 02_03_0351 + 18030656-18030823,18030963-18031113,18031214-180313... 30 5.4 01_06_0773 - 31883625-31884212 30 5.4 05_07_0286 - 28988294-28988383,28988486-28989007,28989117-289897... 29 9.5 >04_04_0596 - 26497863-26497913,26498010-26498081,26499015-26499093, 26499440-26499553,26499822-26499871,26500353-26500398, 26501100-26501719 Length = 343 Score = 33.1 bits (72), Expect = 0.58 Identities = 13/50 (26%), Positives = 29/50 (58%) Frame = +2 Query: 560 RRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERR 709 RR ++R+ ++++ R + D E+ +RK+ ER+++ K EE++ Sbjct: 134 RRRRRRRKEREEEERRRRRKDKERRKRKEKERERERKKKEKKKRRKEEKK 183 >09_04_0512 + 18226981-18227143,18227648-18229555,18229649-18230295, 18230710-18231949,18232085-18232419,18232500-18232577, 18232872-18232978,18233020-18233062 Length = 1506 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = +2 Query: 548 KLDVRRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERR 709 KL+ R +++E K+ ++ K DA+ +K+ EER+++ K EE R Sbjct: 1354 KLERERLKQEKELKQKQEEQKKKRDADVAAKKRQRGEEERKEKQRKRKCTEEAR 1407 >09_04_0087 + 14476539-14476675,14478876-14479635,14479720-14479871, 14479958-14480024,14480632-14480831,14480915-14481068, 14481585-14481669,14481766-14481857,14482575-14482766, 14482867-14482992,14483072-14483125,14483494-14483550, 14484509-14484606,14484703-14485038,14485116-14485203, 14486891-14487016,14487082-14487138,14488054-14488133, 14488228-14488270,14488948-14489034,14489331-14489420, 14489996-14490054,14490141-14490231,14490330-14490495, 14490662-14490755,14491787-14492909 Length = 1537 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +2 Query: 566 TTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKED 733 T K E +K+D E K D EK +++ +E+ + K EE +L +K+D Sbjct: 215 TEKDNEKEKEDKEEETKKDNEK-EKEQLMGTDEKEKEKEKEDENEEEKLEEEEKKD 269 >05_07_0247 + 28643862-28644310,28645151-28645207,28645644-28648950, 28649069-28649144,28649356-28649426,28649524-28649589, 28649677-28649766,28649874-28650050,28650513-28650548 Length = 1442 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +1 Query: 529 KNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKEPEKEDCKC*RKKTAIAEDCNRRRKK 708 K GSL+T RE+ K+ E R E E ++ E E+E + +K ++ R R+K Sbjct: 1101 KEQGSLRTERERE--KDKEASRRLEETKERDKKFEKEREIAEERERKKLEEQEREREREK 1158 Query: 709 TAIAEE 726 +A E Sbjct: 1159 DRLAVE 1164 >04_03_0937 + 20923705-20923833,20924001-20924012,20924413-20924473, 20924523-20924749,20924859-20925104,20925645-20925657, 20927681-20928302,20928320-20928949,20928960-20929224 Length = 734 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +2 Query: 575 KRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKEDCT 739 + EN+ +T + + EKN RK+ + EE ++R + ++R + K EDC+ Sbjct: 124 EHENQGSHITITSRANGEKNMRKRQSEEEEAKKREEEA----KKRDEASKVEDCS 174 >11_06_0152 + 20669949-20670326,20670887-20670997,20671079-20671280, 20671393-20671675,20672145-20672234,20672366-20672473, 20672595-20672975,20673250-20673324,20673685-20673797, 20676233-20676742,20676807-20677300 Length = 914 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +2 Query: 572 KKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRS 679 KK + KKD TR DA K ++K+ EERR S Sbjct: 393 KKGKGKKDFGTRSAPHDARKTSKRKSPLFEERRNSS 428 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 30.3 bits (65), Expect = 4.1 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 518 KRYQKTWEA*KLDVRRTTKKRE--NKKDDLTREMKVDAEKNRRKKTANVEERRQR 676 K YQ+ E + R +KRE ++DD E D K RR+ + +EER++R Sbjct: 506 KEYQRQHEKEREKDRERERKREIMKQEDDSDEE---DNRKRRRRSSGTLEERKRR 557 >05_04_0140 - 18358997-18359082,18359255-18359318,18359469-18359583, 18360101-18360216,18360420-18360541,18360628-18360757, 18361328-18361420 Length = 241 Score = 30.3 bits (65), Expect = 4.1 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -2 Query: 685 LRRSLSSFFNICSLLSPVLFGVYFHFPR*IIFLVLPLFSCSSHV-QFSGFPRFLVSFDQY 509 L SLSSFF S G H ++FLVL LFSC ++V +G F +S ++ Sbjct: 131 LTLSLSSFFTEFSQPKLTHVGYTIHGNVYLVFLVLVLFSCLTYVHNANGIESFNLSRQEH 190 >12_01_0079 + 644754-645932,645966-646061,646193-647122 Length = 734 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +2 Query: 557 VRRTTKKRENKK-DDLTREMKVDAEKNRRKKTAN-VEERRQRSPKTAIVEER 706 V + +K E K+ L +EM + E+ +R++ A VEERR+ + A EER Sbjct: 211 VEKAKRKAEEKRLARLEKEMLEEEERKQREEMAKLVEERRRLRDEKAEAEER 262 >11_01_0078 + 609005-610183,610217-610312,610444-611373 Length = 734 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +2 Query: 557 VRRTTKKRENKK-DDLTREMKVDAEKNRRKKTAN-VEERRQRSPKTAIVEER 706 V + +K E K+ L +EM + E+ +R++ A VEERR+ + A EER Sbjct: 211 VEKAKRKAEEKRLARLEKEMLEEEERKQREEMAKLVEERRRLRDEKAEAEER 262 >08_02_0902 - 22408895-22409620,22410190-22410326,22410550-22410685, 22410787-22411224 Length = 478 Score = 29.9 bits (64), Expect = 5.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 566 TTKKRENKKDDLTREMKVDAE-KNRRKKTANVEERRQ 673 T +NKKDD+T+ +VD E K + A VEE+ Q Sbjct: 393 TVVVEDNKKDDVTKTKQVDGENKVDMRIEATVEEKHQ 429 >05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-282089, 285368-285440,286193-286281,286665-286711,286805-286885, 287011-287179,287381-287600,287679-287744,288194-288310, 288591-288628,288935-289032 Length = 434 Score = 29.9 bits (64), Expect = 5.4 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 5/71 (7%) Frame = +2 Query: 668 RQRSPKTAIVEERRLPSPKKEDCTXDEG*LHRR*-----KMTAPPRKMTAPPRR*LHXRE 832 R+RSP RRL SP+ D G RR + PPR+M +PPRR R Sbjct: 313 RRRSPSPP---PRRLRSPRHLSPRRDRGSPIRRRSPLPRRRLTPPRRMWSPPRRPQSLRH 369 Query: 833 EXSQPAEKXXR 865 P + R Sbjct: 370 RSRSPIHRPIR 380 >02_03_0351 + 18030656-18030823,18030963-18031113,18031214-18031309, 18032027-18032103,18032627-18032706,18033216-18033276, 18034153-18034220,18034312-18034393,18034552-18034638, 18035009-18035086,18035336-18035455,18035554-18035730 Length = 414 Score = 29.9 bits (64), Expect = 5.4 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 9/112 (8%) Frame = +3 Query: 444 NTIS*EKTNKES*DDNRRKLN*Y*SKDTKKRGKPENWT*EEQLKRGRTRKMI*RGK*K*T 623 NTI+ + NK S K+ +++ ++R + + E +++R R ++ I GK Sbjct: 168 NTIT--EANKPSLSPEEMKIK---AQELRERARKKKEEEERRMEREREKERIRIGKELLE 222 Query: 624 PKRT---GERR----LQMLKKEDSDRRR--LQSSKKEDCHRRRRKTAPPMKD 752 KR ER+ L+ L+KE+ R R ++ +ED RRRK P +D Sbjct: 223 AKRIEEDNERKRMIELRRLEKEEEKRAREKIRQKLEEDKAERRRKLGLPPED 274 >01_06_0773 - 31883625-31884212 Length = 195 Score = 29.9 bits (64), Expect = 5.4 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = +1 Query: 628 KEPEKEDCKC*RKKTAIAEDCNRRRKKTAIAEEGRLHXR*RMTAPPMKDDCTAEKDDCTA 807 KE EKE K + + A RRRK+TA G APP + EK+ A Sbjct: 97 KEKEKEKAKAAQAQAPAAARRRRRRKETADEAAGGRAASNAAAAPPTRVGSEGEKERLLA 156 Query: 808 EK 813 + Sbjct: 157 NE 158 >05_07_0286 - 28988294-28988383,28988486-28989007,28989117-28989758, 28990554-28990597,28990836-28991016 Length = 492 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = -1 Query: 1394 RPNXGWGIGGFPRXSPPGVSPEKFPRQKPFPGLXGVXKGFG 1272 RP + P PP +P FP PFP G G G Sbjct: 332 RPVADGAVLPAPMQQPPPATPPFFPPSIPFPASSGAGDGTG 372 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,082,268 Number of Sequences: 37544 Number of extensions: 515645 Number of successful extensions: 1495 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1450 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4803272712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -