BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H02_e592_16.seq (1499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 36 0.069 At3g28770.1 68416.m03591 expressed protein 34 0.28 At1g04850.1 68414.m00481 ubiquitin-associated (UBA)/TS-N domain-... 33 0.49 At4g36700.1 68417.m05208 cupin family protein low similarity to ... 33 0.64 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 33 0.64 At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacu... 32 0.85 At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacu... 32 0.85 At4g11100.1 68417.m01802 expressed protein 32 0.85 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 32 0.85 At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-... 32 1.1 At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein /... 32 1.1 At5g46020.1 68418.m05659 expressed protein 31 1.5 At5g36650.1 68418.m04383 hypothetical protein 31 1.5 At4g02110.1 68417.m00282 BRCT domain-containing protein contains... 31 1.5 At4g26630.1 68417.m03837 expressed protein 31 2.0 At5g41320.1 68418.m05022 expressed protein 30 3.4 At4g35940.1 68417.m05113 expressed protein 30 3.4 At5g57120.1 68418.m07132 expressed protein weak similarity to SP... 29 6.0 At3g51650.1 68416.m05664 expressed protein 29 6.0 At3g06720.2 68416.m00797 importin alpha-1 subunit, putative (IMP... 29 6.0 At3g06720.1 68416.m00796 importin alpha-1 subunit, putative (IMP... 29 6.0 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 29 6.0 At2g16485.1 68415.m01889 expressed protein ; expression supporte... 29 7.9 At1g29570.1 68414.m03616 zinc finger protein-related contains si... 29 7.9 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 35.9 bits (79), Expect = 0.069 Identities = 39/169 (23%), Positives = 60/169 (35%), Gaps = 1/169 (0%) Frame = +2 Query: 560 RRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKEDCT 739 RR T + + +R + + RR+++ + RR+RSP R P ++ + Sbjct: 293 RRPTHEGRRQSPAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPARRHRSPTPPARQRRS 352 Query: 740 XDEG*LHRR*KMTAPPRKMTAPPRR*LHXREEXSQPAEKXXRRNCTAEKRLXXXXEXAPX 919 R A R+ +PP R R S PA RR + +P Sbjct: 353 PSPPARRHRSPPPARRRRSPSPPAR---RRRSPSPPA----RRRRSPSPLYRRNRSPSPL 405 Query: 920 XRNXIXXKXLHPRXETASPKRX-APXKRTASPKGTAXXKETXPQKNPPP 1063 R L R + SP R +P R P G + Q+ P P Sbjct: 406 YRRNRSRSPLAKRGRSDSPGRSPSPVARLRDPTGARLPSPSIEQRLPSP 454 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 33.9 bits (74), Expect = 0.28 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = +2 Query: 575 KRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKEDCTXDE 748 K ENK + +E + A KNR KK EE++ ++ + A E+++ K+E+ +E Sbjct: 990 KEENKDNKEKKESEDSASKNREKK--EYEEKKSKTKEEAKKEKKKSQDKKREEKDSEE 1045 >At1g04850.1 68414.m00481 ubiquitin-associated (UBA)/TS-N domain-containing protein weak similarity to SP|P45974 Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15) {Homo sapiens}; contains Pfam profile PF00627: UBA/TS-N domain Length = 413 Score = 33.1 bits (72), Expect = 0.49 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 9/92 (9%) Frame = +3 Query: 516 SKDTKKRGKPENWT*EEQLKRGRTRKMI*RGK*K*TPKRTGE----RRLQMLKKEDSD-- 677 +++ ++R + + E++++R R ++ I GK KR E +RL L+K + + Sbjct: 185 AQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRMEEVNERKRLMFLRKAEKEEE 244 Query: 678 ---RRRLQSSKKEDCHRRRRKTAPPMKDDCTA 764 R +++ +ED RRRK P +D TA Sbjct: 245 KRAREKIRQKLEEDKAERRRKLGLPPEDPATA 276 >At4g36700.1 68417.m05208 cupin family protein low similarity to preproMP27-MP32 from Cucurbita cv. Kurokawa Amakuri [GI:691752]; contains Pfam profile PF00190: Cupin Length = 522 Score = 32.7 bits (71), Expect = 0.64 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 3/81 (3%) Frame = +2 Query: 515 IKRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERR---QRSPK 685 I++ + E K+D R + E KK++ E K + E+ RRK+ E++R Q+ P+ Sbjct: 443 IEKLKVEIERKKIDDERKRRHDERKKEE--EEAKRE-EEERRKREEEEEKKRWPPQQPPQ 499 Query: 686 TAIVEERRLPSPKKEDCTXDE 748 + ER+LP K+ + +E Sbjct: 500 EEELRERQLPMEKEWEMEGEE 520 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 32.7 bits (71), Expect = 0.64 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 7/112 (6%) Frame = +2 Query: 764 R*KMTAPPRKMTAPPRR*LHXREEXSQPAEKXXRRNCTAEKRLXXXXEXAPXXRNXIXXK 943 R K+++PP+ ++A P+R + + AEK E +P R+ + + Sbjct: 178 RQKVSSPPKPVSAAPKRDAPKSDNAAADAEKDGGPRRPRETSPQRKTGLSPRRRSPLPRR 237 Query: 944 XLHPRXETA-SPKRXAP----XKRTASP--KGTAXXKETXPQKNPPPKRTAS 1078 L PR + SP R P +R +P + A +PPP+R S Sbjct: 238 GLSPRRRSPDSPHRRRPGSPIRRRGDTPPRRRPASPSRGRSPSSPPPRRYRS 289 Score = 32.3 bits (70), Expect = 0.85 Identities = 38/156 (24%), Positives = 59/156 (37%), Gaps = 6/156 (3%) Frame = +2 Query: 623 AEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKEDCTXDEG*LHRR*KMTAPPRKMTA 802 A +R + ++ RR RSP R SP + L RR + PPR++ + Sbjct: 271 ASPSRGRSPSSPPPRRYRSPPRGSPRRIR-GSPVRRRSPLP---LRRR---SPPPRRLRS 323 Query: 803 PPRR*LHXREEXSQPAEKXXRRNCTAEKRLXXXXEXAPXXRNXIXXKXLHPR------XE 964 PPRR R P + R ++ R+ PR Sbjct: 324 PPRR-SPIRRRSRSPIRRPGRSRSSSISPRKGRGPAGRRGRSSSYSSSPSPRRIPRKISR 382 Query: 965 TASPKRXAPXKRTASPKGTAXXKETXPQKNPPPKRT 1072 + SPKR KR++S ++ + P PPP++T Sbjct: 383 SRSPKRPLRGKRSSSNSSSS----SSPPPPPPPRKT 414 >At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 32.3 bits (70), Expect = 0.85 Identities = 16/77 (20%), Positives = 33/77 (42%) Frame = +2 Query: 518 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIV 697 +R WE +++ + + +E KD + RE + AEK + + E + + V Sbjct: 398 ERESDRWERERMEQKDRERNKEKDKDHIKREPRTGAEKEISQNEKELGEASAKPSEQEYV 457 Query: 698 EERRLPSPKKEDCTXDE 748 + + ++C DE Sbjct: 458 APEQKKQNEPDNCEKDE 474 >At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 32.3 bits (70), Expect = 0.85 Identities = 16/77 (20%), Positives = 33/77 (42%) Frame = +2 Query: 518 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIV 697 +R WE +++ + + +E KD + RE + AEK + + E + + V Sbjct: 398 ERESDRWERERMEQKDRERNKEKDKDHIKREPRTGAEKEISQNEKELGEASAKPSEQEYV 457 Query: 698 EERRLPSPKKEDCTXDE 748 + + ++C DE Sbjct: 458 APEQKKQNEPDNCEKDE 474 >At4g11100.1 68417.m01802 expressed protein Length = 287 Score = 32.3 bits (70), Expect = 0.85 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 515 IKRYQKTWEA*KLDVRRTTKKRENKKDDLTRE-MKVDAEKNRRKKTANVEERRQRSPKTA 691 IK ++ +EA KL K+ E L E MK EK + +KT ++ S +TA Sbjct: 34 IKHAEEAYEAIKLHHENKAKELEVSNKRLLEECMKERREKAKVRKTFEEMKKTMESERTA 93 Query: 692 IVEE 703 IV+E Sbjct: 94 IVDE 97 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 32.3 bits (70), Expect = 0.85 Identities = 38/156 (24%), Positives = 59/156 (37%), Gaps = 6/156 (3%) Frame = +2 Query: 623 AEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKEDCTXDEG*LHRR*KMTAPPRKMTA 802 A +R + ++ RR RSP R SP + L RR + PPR++ + Sbjct: 264 ASPSRGRSPSSPPPRRYRSPPRGSPRRIR-GSPVRRRSPLP---LRRR---SPPPRRLRS 316 Query: 803 PPRR*LHXREEXSQPAEKXXRRNCTAEKRLXXXXEXAPXXRNXIXXKXLHPR------XE 964 PPRR R P + R ++ R+ PR Sbjct: 317 PPRR-SPIRRRSRSPIRRPGRSRSSSISPRKGRGPAGRRGRSSSYSSSPSPRRIPRKISR 375 Query: 965 TASPKRXAPXKRTASPKGTAXXKETXPQKNPPPKRT 1072 + SPKR KR++S ++ + P PPP++T Sbjct: 376 SRSPKRPLRGKRSSSNSSSS----SSPPPPPPPRKT 407 >At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-related similar to CCAAT-box-binding transcription factor (CCAAT-binding factor) (CBF) (Swiss-Prot:Q03701) [Homo sapiens], GB:P53569 [Mus musculus] Length = 1056 Score = 31.9 bits (69), Expect = 1.1 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 14/100 (14%) Frame = +1 Query: 469 IRNHKMTTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKEP---- 636 + + +M TD ++ ID + NV TG ++ +G+ R + E R+RK P Sbjct: 959 VSDAEMDTDMDMDLIDDEDDNNVDDDGTGDGGDDDSDGDDGRSKKKKKEKRKRKSPFASL 1018 Query: 637 ----------EKEDCKC*RKKTAIAEDCNRRRKKTAIAEE 726 EKED K RK T +E +++KK + A E Sbjct: 1019 EEYKHLIDQDEKEDSKTKRKAT--SEPTKKKKKKKSKASE 1056 >At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus}; similar to GI:807956 from [Saccharomyces cerevisiae]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 573 Score = 31.9 bits (69), Expect = 1.1 Identities = 25/101 (24%), Positives = 42/101 (41%), Gaps = 8/101 (7%) Frame = +2 Query: 527 QKTWEA*KLDVRRTTKKRENKKDDLTREMKVD--------AEKNRRKKTANVEERRQRSP 682 +KT E + + +K E KK++ T E+KV+ AE+ + + A VE + + P Sbjct: 123 EKTEEKKTEEETKEEEKTEEKKEETTTEVKVEEEKPAVPAAEEEKSSEAAPVETKSEEKP 182 Query: 683 KTAIVEERRLPSPKKEDCTXDEG*LHRR*KMTAPPRKMTAP 805 + S +ED T + +PP AP Sbjct: 183 EEKAEVTTEKASSAEEDGTKTVEAIEESIVSVSPPESAVAP 223 >At5g46020.1 68418.m05659 expressed protein Length = 164 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/69 (23%), Positives = 37/69 (53%) Frame = +2 Query: 527 QKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEER 706 QKT +A LD +TT+ ++++L ++ + R ++ E+ R+ + A++ ++ Sbjct: 82 QKTLKAKDLDASKTTELSRREREELEKQ-RAHERYMRLQEQGKTEQARKDLDRLALIRQQ 140 Query: 707 RLPSPKKED 733 R + KK + Sbjct: 141 REEAAKKRE 149 >At5g36650.1 68418.m04383 hypothetical protein Length = 158 Score = 31.5 bits (68), Expect = 1.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 642 RRLQMLKKEDSDRRRLQSSKKEDCHRRRRKTAPPMKDDCT 761 RR+ E+ RR L+ ++DC RRR T K D T Sbjct: 33 RRVATAAGEEESRRLLEKKSRDDCRRRRTATEKKKKLDRT 72 >At4g02110.1 68417.m00282 BRCT domain-containing protein contains Pfam domain, PF00533: BRCA1 C Terminus (BRCT) domain Length = 1293 Score = 31.5 bits (68), Expect = 1.5 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +2 Query: 569 TKKRENKKDD--LTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKED 733 T+K KD +++VD +K +R+K A VEE R ++P ++ KKED Sbjct: 818 TRKEAATKDPSYAAAQLEVDTKKGKRRKQATVEENRLQTPSV-----KKAKVSKKED 869 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 31.1 bits (67), Expect = 2.0 Identities = 32/171 (18%), Positives = 62/171 (36%), Gaps = 11/171 (6%) Frame = +2 Query: 554 DVRRTTKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVE--ERRLPSPKK 727 + + KK DD + E K + EK +K EE+++ + I + E P P + Sbjct: 507 EATKVVKKSLAHSDDESEEEKEEEEKQEEEKAEEKEEKKEEENENGIPDKSEDEAPQPSE 566 Query: 728 EDCTXDEG*LH---------RR*KMTAPPRKMTAPPRR*LHXREEXSQPAEKXXRRNCTA 880 + DE H R +++A ++ R S P EK ++ +A Sbjct: 567 SE-EKDESEEHSEEETTKKKRGSRLSAGKKESAGRARNKKAVVAAKSSPPEKITQKRSSA 625 Query: 881 EKRLXXXXEXAPXXRNXIXXKXLHPRXETASPKRXAPXKRTASPKGTAXXK 1033 +++ + K +P + +P + A ++ G K Sbjct: 626 KRKKTDDDSDTSPKASSKRKKSENPIKASPAPSKSASKEKPVKRAGKGKDK 676 >At5g41320.1 68418.m05022 expressed protein Length = 515 Score = 30.3 bits (65), Expect = 3.4 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 569 TKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQR 676 T+KR +KKD+ T+ KV + R+ KT VE+ +++ Sbjct: 63 TRKRRSKKDE-TKPEKVKQVRKRKPKTVCVEDNKKK 97 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +2 Query: 557 VRRTTKKRENKKDDLT-REMKVDAEKNRRKKTANVEERRQRSPKTAIVEERRLPSPKKED 733 V KK + +KD + ++ K D ++ + KK ++R++R K E+R +KED Sbjct: 30 VEEKAKKEQRRKDRRSDKKDKKDKKERKEKKEKKEKKRKEREGKEVGSEKRSHKRRRKED 89 >At5g57120.1 68418.m07132 expressed protein weak similarity to SP|Q14978 Nucleolar phosphoprotein p130 {Homo sapiens} Length = 330 Score = 29.5 bits (63), Expect = 6.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 554 DVRRTTKKRENKKDDLTREMKVD--AEKNRRKKTANVEERRQRSPKTAIVE 700 D + +KKR+ + + T+E D E RRKK NV E + +T + E Sbjct: 169 DKEKVSKKRKRSEPEETKEETEDDDEESKRRKKEENVVENDEGVQETPVKE 219 >At3g51650.1 68416.m05664 expressed protein Length = 826 Score = 29.5 bits (63), Expect = 6.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 569 TKKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERR 709 T E++ + R+ + + K+ + EER+QR +VEERR Sbjct: 245 TSSHESRVEKARRKAEEKRQARLEKEHSEEEERKQREEVARLVEERR 291 >At3g06720.2 68416.m00797 importin alpha-1 subunit, putative (IMPA1) similar to importin alpha-1 subunit (Karyopherin alpha-1 subunit, KAP alpha) [Arabidopsis thaliana] SWISS-PROT:Q96321 Length = 532 Score = 29.5 bits (63), Expect = 6.0 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +2 Query: 578 RENKKDDLTR---EMKVDAEKNRRKKTANVEERRQRSPKTAIVEERR 709 R N K ++ R ++ VDAE+ RR++ N+ E R+ + +++++RR Sbjct: 4 RPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRR 50 >At3g06720.1 68416.m00796 importin alpha-1 subunit, putative (IMPA1) similar to importin alpha-1 subunit (Karyopherin alpha-1 subunit, KAP alpha) [Arabidopsis thaliana] SWISS-PROT:Q96321 Length = 532 Score = 29.5 bits (63), Expect = 6.0 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +2 Query: 578 RENKKDDLTR---EMKVDAEKNRRKKTANVEERRQRSPKTAIVEERR 709 R N K ++ R ++ VDAE+ RR++ N+ E R+ + +++++RR Sbjct: 4 RPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRR 50 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 29.5 bits (63), Expect = 6.0 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = +1 Query: 547 KTGREKNN*KEGEQER*FNEGNESRRRKEPEKEDCK-C*RKKTAIAEDCNRRRKKTAIAE 723 K RE+ K+ E+ER + R R+E EKE K R++ E R R+K + Sbjct: 135 KRDREREERKDKEREREKDRERREREREEREKERVKERERREREDGERDRREREKERGSR 194 Query: 724 EGRLHXR*RMTAPPMKDD 777 R R R DD Sbjct: 195 RNRERERSREVGNEESDD 212 >At2g16485.1 68415.m01889 expressed protein ; expression supported by MPSS Length = 617 Score = 29.1 bits (62), Expect = 7.9 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +2 Query: 572 KKRENKKDDLTREMKVDAEKNRRKKTANVEERRQRSPKTAIVEERR 709 K + +KDD ++ D E +R A++EE R+ + E ++ Sbjct: 446 KDEDQEKDDNMTDLAEDVENHRDSSVADIEEGREDHEDMGVTETQK 491 >At1g29570.1 68414.m03616 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 321 Score = 29.1 bits (62), Expect = 7.9 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 518 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDA-EKNRRKKTANVEERRQR 676 + + W + + R ++R +++L + + D+ E+ RR+ N++E+RQR Sbjct: 160 RHHDTEWRFERERMERIERQRREAEENLQEQRQRDSIERQRREAEENLQEQRQR 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,916,674 Number of Sequences: 28952 Number of extensions: 407152 Number of successful extensions: 1391 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1358 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4000015680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -