BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_H01_e584_15.seq (1573 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal prot... 104 1e-22 >U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal protein, small subunitprotein 2 protein. Length = 272 Score = 104 bits (250), Expect = 1e-22 Identities = 55/74 (74%), Positives = 58/74 (78%) Frame = +1 Query: 214 EDQKEWVPVTKLGRLVREGKIDKLESIYLFSLPIKXFEIIDFFLGPSLNDEVLKIMPVQK 393 E + EW PVTKLGRLV+E KI LE IYL SLPIK FEIID L +L DEVLKI PVQK Sbjct: 52 EKETEWTPVTKLGRLVKEKKITTLEEIYLNSLPIKEFEIID-ALCSNLKDEVLKISPVQK 110 Query: 394 QTRAGQRTRFKAFV 435 QT AGQRTRFKAFV Sbjct: 111 QTTAGQRTRFKAFV 124 Score = 64.1 bits (149), Expect = 3e-10 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +2 Query: 437 AIGDNNGHIGLGVKXSKEVXXAIRGXIILAKLAVLPVPXRFIGVTKIGKPXT 592 AIGD+ GH+GLGVK SKEV AIRG I+ AKLAV+PV + G KIG P T Sbjct: 125 AIGDHAGHVGLGVKCSKEVATAIRGAIVAAKLAVVPVRRGYWG-NKIGLPHT 175 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,786,756 Number of Sequences: 27780 Number of extensions: 249785 Number of successful extensions: 590 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4545957324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -