BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_G11_e663_13.seq (1556 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0464 - 8683232-8684596 33 0.61 01_01_0998 - 7894254-7894515,7895133-7895270,7896049-7896246,789... 29 7.5 >03_02_0464 - 8683232-8684596 Length = 454 Score = 33.1 bits (72), Expect = 0.61 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 428 PSCQQATPFLHQTLSRFARLLSSNPSSPHRVRLPSCTSRHWSF 556 PS A+PFL + + + PSSPH ++P T+R SF Sbjct: 157 PSSPCASPFLSPLSPQSLSITPAVPSSPHNRQIPQATTRQSSF 199 >01_01_0998 - 7894254-7894515,7895133-7895270,7896049-7896246, 7896334-7896786,7896877-7897098,7898100-7898227, 7899325-7899432 Length = 502 Score = 29.5 bits (63), Expect = 7.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 486 FYHPTQVLHTESDFLAVPPVIG 551 FY+ T+VLH E+ FL VIG Sbjct: 324 FYYQTEVLHLEASFLGTARVIG 345 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,108,681 Number of Sequences: 37544 Number of extensions: 502444 Number of successful extensions: 799 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5023712764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -