BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_G09_e647_13.seq (1604 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9HIY9 Cluster: Conserved hypothetical membrane protein... 35 6.9 >UniRef50_Q9HIY9 Cluster: Conserved hypothetical membrane protein; n=1; Thermoplasma acidophilum|Rep: Conserved hypothetical membrane protein - Thermoplasma acidophilum Length = 390 Score = 34.7 bits (76), Expect = 6.9 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +1 Query: 190 RQPLRGLCVSAVSILFCIFILWYRSAVVKLLPLDGICAARDVANIFGLNIVSEL 351 R +R L +S++ I IFI WY +AV ++ L G DV+ F N +S L Sbjct: 55 RTLIRWLQLSSLVIEVFIFIAWYLNAVPSIILLSGFLMYVDVSEAFYFNAMSAL 108 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 885,177,379 Number of Sequences: 1657284 Number of extensions: 15300541 Number of successful extensions: 25649 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25648 length of database: 575,637,011 effective HSP length: 104 effective length of database: 403,279,475 effective search space used: 173410174250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -