BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_G08_e639_14.seq (1585 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 4.7 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 6.2 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 4.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 643 PPEAPYSAIHVGAAAPTMPSSSY 711 PP PY+ I G ++P M S SY Sbjct: 123 PPSHPYTVISNGYSSP-MSSGSY 144 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 613 YSPVTDVXATPPEAPYSAIHVGAAAPTMPS 702 +SP AT E YSA G + P++ S Sbjct: 108 WSPAATAAATATEYKYSAAAPGPSDPSVSS 137 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,880 Number of Sequences: 336 Number of extensions: 4367 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 47832475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -