BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_G05_e615_13.seq (1602 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyce... 28 4.1 SPBC6B1.04 |mde4||monopolin-like complex subunit Mde4|Schizosacc... 27 7.2 >SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 681 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +2 Query: 143 SLHSLLGNKPNLAVNIESIKAVSESKSQ 226 SL+SL+GNK N S KA SESKSQ Sbjct: 543 SLNSLVGNKSE---NSSSSKAKSESKSQ 567 >SPBC6B1.04 |mde4||monopolin-like complex subunit Mde4|Schizosaccharomyces pombe|chr 2|||Manual Length = 421 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = -2 Query: 383 EAFXVRVK*PESQWSIRCQSVLFSLHRRLEKQLIPKRIYGFXSLPYRPRILPPGFYS 213 + F ++++ ES W +R Q + L + K + K+ SL PR+ P +S Sbjct: 196 DRFKIKLETEESNWKVRLQVLESKLATQDRKLRMQKKSTERKSLLVSPRVSSPKLFS 252 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,585,250 Number of Sequences: 5004 Number of extensions: 37676 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 905853518 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -