BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_G05_e615_13.seq (1602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g13700.1 68414.m01610 glucosamine/galactosamine-6-phosphate i... 30 4.9 >At1g13700.1 68414.m01610 glucosamine/galactosamine-6-phosphate isomerase family protein similar to SP|O95336 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL) {Homo sapiens}; contains Pfam profile PF01182: Glucosamine-6-phosphate isomerase/6-phosphogluconolactonase Length = 268 Score = 29.9 bits (64), Expect = 4.9 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +2 Query: 59 GXDKDGHVAMLF-NKSEQDIKNNXQAFITSLHSLLGNKPNLAVNIESIKAVSESKSQVVI 235 G DGHVA LF N ++K++ F+T H KP ++ ++ + + VV+ Sbjct: 157 GMGSDGHVASLFPNHPALEVKDDWVTFLTDSH-----KPPPERITFTLPVINSAANVVVV 211 Query: 236 YVVDKGAXXTHISASEL 286 + A H++ +L Sbjct: 212 ATGESKANAIHLAIDDL 228 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,116,804 Number of Sequences: 28952 Number of extensions: 214086 Number of successful extensions: 505 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4327727808 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -