BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_G04_e607_14.seq (1550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 29 0.36 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 26 3.4 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 29.1 bits (62), Expect = 0.36 Identities = 11/19 (57%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = +3 Query: 312 YYNYYCSHKSQH--RCWFR 362 YYNYYC + S H RC++R Sbjct: 164 YYNYYCRNISHHFLRCFYR 182 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 25.8 bits (54), Expect = 3.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 272 GAEVALLGDRLPDPTDVELGEGGIFILHEKY 180 G ++ L G R+P TD+ +G + + EKY Sbjct: 392 GRDIVLQGYRVPSDTDIAMG-AQVLLRDEKY 421 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,134,681 Number of Sequences: 2352 Number of extensions: 20578 Number of successful extensions: 56 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 182471355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -