BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F12_e670_12.seq (1512 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 25 4.3 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 25 5.7 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 5.7 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 7.6 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 25 7.6 AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-l... 25 7.6 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 25 7.6 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 25 7.6 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 25.4 bits (53), Expect = 4.3 Identities = 21/79 (26%), Positives = 35/79 (44%) Frame = -3 Query: 424 LPSVYGRNLHGRRYAPFYLPRPLLVPDPTSPYRILHLLLHYPQTHPTHLTPRNRNRNRHR 245 LPSV R+ ++ L +P TS + L P T + L RN++ Sbjct: 184 LPSVSFRSGFSTGFSKALDATILALPGSTSNVSVF-FLKPSPDTDVSTLETHLRNQSISS 242 Query: 244 ILPPFPHQSVRMRHLLLQI 188 +L FP ++VR + +Q+ Sbjct: 243 VLKLFPDETVRSAYTEVQL 261 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 25.0 bits (52), Expect = 5.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 414 FTVEIFTVVDTLLFIF 367 FT EIF+ + TLLFIF Sbjct: 561 FTQEIFSALITLLFIF 576 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.0 bits (52), Expect = 5.7 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 643 HHKSSHHERDRKSEHNKSSSKDSKRHS 723 HH HH + +S KDS R S Sbjct: 160 HHHHHHHHNAPAGGESSTSEKDSSRES 186 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 7.6 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +1 Query: 643 HHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESR 765 HH HH ++H +++ D+ + S + +R SR Sbjct: 656 HHHHHHHHHQNPNDHFVNTNTDTIKRSHSAQLPQREDARSR 696 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 24.6 bits (51), Expect = 7.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 661 HERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDR 777 H++ S H+ SSS RH + R+RD R+ R Sbjct: 625 HDKYGSSRHSDSSS----RHRSSKHERDRSRDRDRDRRR 659 Score = 24.2 bits (50), Expect = 10.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 646 HKSSHHERDRKSEHNK 693 H+SS HERDR + ++ Sbjct: 640 HRSSKHERDRSRDRDR 655 >AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-like 3 protein protein. Length = 269 Score = 24.6 bits (51), Expect = 7.6 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -3 Query: 208 RHLLLQILRPADRFQHRTRDLGRTSPRFQRTLRYHXVMV 92 RHL+ Q + + QH S R QR L H ++V Sbjct: 5 RHLIEQAWQYGAQLQHELMLTSMESDRVQRALVLHSMLV 43 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 24.6 bits (51), Expect = 7.6 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 167 KTISRTKNLK-KKMTHTNRLMRKRRKNPMTVPITIPRRQMSRMRLGIVKKKMKNPVRTGR 343 +T +R + L+ +K HTN + +RR+ M + + RQ+ ++ + K+K ++ + Sbjct: 224 QTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQI-KIWFQNRRMKLKKEIQAIK 282 Query: 344 IWNEK 358 NE+ Sbjct: 283 ELNEQ 287 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 24.6 bits (51), Expect = 7.6 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 167 KTISRTKNLK-KKMTHTNRLMRKRRKNPMTVPITIPRRQMSRMRLGIVKKKMKNPVRTGR 343 +T +R + L+ +K HTN + +RR+ M + + RQ+ ++ + K+K ++ + Sbjct: 241 QTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQI-KIWFQNRRMKLKKEIQAIK 299 Query: 344 IWNEK 358 NE+ Sbjct: 300 ELNEQ 304 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 719,358 Number of Sequences: 2352 Number of extensions: 11298 Number of successful extensions: 37 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177188220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -