BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F12_e670_12.seq (1512 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 31 0.034 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 29 0.079 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 29 0.079 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 29 0.079 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 29 0.10 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 29 0.10 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 29 0.10 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 29 0.10 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 29 0.10 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 29 0.10 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 29 0.10 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 29 0.10 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 29 0.10 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 29 0.10 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 29 0.10 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 29 0.14 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 29 0.14 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 29 0.14 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 29 0.14 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 29 0.14 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 29 0.14 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 27 0.32 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 27 0.56 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 27 0.56 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 27 0.56 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 27 0.56 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 27 0.56 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 27 0.56 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 27 0.56 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 27 0.56 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 27 0.56 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 27 0.56 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 26 0.74 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 26 0.74 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 26 0.74 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 26 0.74 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 26 0.74 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 26 0.74 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 26 0.74 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 26 0.74 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 26 0.74 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 26 0.74 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 26 0.74 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 26 0.74 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 26 0.74 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 26 0.74 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 26 0.74 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 26 0.74 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 26 0.74 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 26 0.74 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 26 0.98 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 26 0.98 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 26 0.98 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 26 0.98 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 26 0.98 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 26 0.98 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 26 0.98 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 25 1.3 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 24 3.0 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 3.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 6.9 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 9.1 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 30.7 bits (66), Expect = 0.034 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R + +RS Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNERKYRKYRERS 63 Score = 24.2 bits (50), Expect = 3.0 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N+ + + S ++ + R+ SRE Sbjct: 40 SRSREREQKSYKNERKYRKYRERSKERSRDRTERERSRE 78 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 29.5 bits (63), Expect = 0.079 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETS 63 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 29.5 bits (63), Expect = 0.079 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETS 63 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 29.5 bits (63), Expect = 0.079 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRRYEKLHNEKEKLLEERTSRERYSRSREREQKSYKNEREYRKYGETS 296 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 63 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 63 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 63 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 63 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 296 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 296 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 296 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 296 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 296 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 237 KDRRYEKLHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETS 285 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 29.1 bits (62), Expect = 0.10 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRQYEKLHNEKEKFLEERTSHKRYSRSREREQKSYKNEREYRKYRETS 296 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 63 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 296 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.14 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRENDRS 780 +D+ ++ H+E+++ E S + S+ +QK +K R+ + + S Sbjct: 248 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETS 296 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 28.7 bits (61), Expect = 0.14 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARD 756 +D+ ++ H+E+++ E S + S+ +QK +K R+ Sbjct: 237 KDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNERE 277 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 27.5 bits (58), Expect = 0.32 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N++S + + S ++ +R R SRE+ Sbjct: 273 SRSREREQKSYKNENSYRKYRETSKERSRDRRERGRSREH 312 Score = 25.4 bits (53), Expect = 1.3 Identities = 13/54 (24%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+ + E S + S+ +QK +K + R+ S+E R Sbjct: 248 KDRRYEKLHNEKKKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 301 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 68 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 68 Score = 25.8 bits (54), Expect = 0.98 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + S ++ + R+ SRE Sbjct: 40 SRSREREQKSYKNENSYRKYRETSKERSRDRTERERSRE 78 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 248 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 301 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 237 KDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 290 Score = 25.8 bits (54), Expect = 0.98 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + S ++ + R+ SRE Sbjct: 262 SRSREREQKSYKNENSYRKYRETSKERSRDRTERERSRE 300 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 26.6 bits (56), Expect = 0.56 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 288 SRSREREQKSYKNEREYREYRETSRERSRDRRGRGRSREH 327 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 248 KDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 301 Score = 25.8 bits (54), Expect = 0.98 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + S ++ + R+ SRE Sbjct: 273 SRSREREQKSYKNENSYRKYRETSKERSRDRTERERSRE 311 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 248 KDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 301 Score = 25.8 bits (54), Expect = 0.98 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + S ++ + R+ SRE Sbjct: 273 SRSREREQKSYKNENSYRKYRETSKERSRDRTERERSRE 311 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 237 KDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 290 Score = 25.8 bits (54), Expect = 0.98 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + S ++ + R+ SRE Sbjct: 262 SRSREREQKSYKNENSYRKYRETSKERSRDRTERERSRE 300 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 248 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 301 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 26.6 bits (56), Expect = 0.56 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S+ +QK +K + R+ S+E R Sbjct: 253 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSR 306 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 26.2 bits (55), Expect = 0.74 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 51 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + ++ + R+ SRE Sbjct: 40 SRSREREQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 26.2 bits (55), Expect = 0.74 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 51 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + ++ + R+ SRE Sbjct: 40 SRSREREQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 26.2 bits (55), Expect = 0.74 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 51 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + ++ + R+ SRE Sbjct: 40 SRSREREQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 26.2 bits (55), Expect = 0.74 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 51 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + ++ + R+ SRE Sbjct: 40 SRSREREQKSYKNENSYRKYRETWKERSRDRTERERSRE 78 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 40 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 79 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 40 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 79 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 40 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 79 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 40 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 79 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 40 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 79 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 40 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 79 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 40 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 79 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 289 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 328 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 289 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 328 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 289 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 328 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 289 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 328 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 289 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 328 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 289 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 328 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREN 771 S ER++KS N+ ++ + S ++ +R R SRE+ Sbjct: 289 SRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREH 328 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.98 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKFLEERTSRKRYSRSREREQKSYK 51 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.98 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKFLEERTSRKRYSRSREREQKSYK 51 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.98 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKFLEERTSRKRYSRSREREQKSYK 51 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.98 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKFLEERTSRKRYSRSREREQKSYK 51 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.98 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKFLEERTSRKRYSRSREREQKSYK 51 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.8 bits (54), Expect = 0.98 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK 744 +D+ ++ H+E+++ E S + S+ +QK +K Sbjct: 15 KDRRYEKLHNEKEKFLEERTSRKRYSRSREREQKSYK 51 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.8 bits (54), Expect = 0.98 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N++S + + S ++ + R+ SRE Sbjct: 273 SCSREREQKSYKNENSYRKYRETSKERSRDRTERERSRE 311 Score = 24.6 bits (51), Expect = 2.3 Identities = 13/54 (24%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = +1 Query: 634 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHK------RARDESRENDR 777 +D+ ++ H+E+++ E S + S +QK +K + R+ S+E R Sbjct: 248 KDRRYEKLHNEKEKLLEERTSRKRYSCSREREQKSYKNENSYRKYRETSKERSR 301 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 25.4 bits (53), Expect = 1.3 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +2 Query: 203 MTHTNRLMRKRRKNPMTVPITIPRRQMSRMRLGIVKKKMKNPVRTGRIWNEKR 361 +++ NRL+R N T+ + Q+ +++ +KN V T +W E+R Sbjct: 42 LSNYNRLIRPVMNNTETLTV-----QLGLKLSQLIEMNLKNQVMTTNVWVEQR 89 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 24.2 bits (50), Expect = 3.0 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER++KS N+ + + S ++ + R+ SRE Sbjct: 40 SRSREREQKSYKNERKYRKYRERSKERSRDRTERERSRE 78 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +1 Query: 652 SSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESRE 768 S ER+++S N++S + + S ++ + R+ SRE Sbjct: 273 SRSREREQRSYKNENSYRKYRETSKERSRDRIERERSRE 311 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/44 (20%), Positives = 24/44 (54%) Frame = +1 Query: 643 HHKSSHHERDRKSEHNKSSSKDSKRHSGDQKXHKRARDESREND 774 + ++ + + D K N+ + D+KR+ Q ++ ++++ ND Sbjct: 493 NRQNGNKQNDNKQNGNRQN--DNKRNGNRQNDNQNNQNDNNRND 534 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.6 bits (46), Expect = 9.1 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 140 PS*IPSPMLKTISRTKNLKKKMTHTNRLMRKRRKNPMTVPITIP 271 P I S KTI N KK+ + N + + P+ VPI +P Sbjct: 79 PKIISSLSNKTIHNNNNNYKKLQYYN--INYIEQIPVPVPIPVP 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,417 Number of Sequences: 438 Number of extensions: 3356 Number of successful extensions: 113 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52874250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -