BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F11_e662_11.seq (1584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 26 3.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 7.9 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 25.8 bits (54), Expect = 3.4 Identities = 19/71 (26%), Positives = 31/71 (43%) Frame = -2 Query: 668 TVSAIEKSTXKENKITITXXKGRLSKEEIERMVNEAEKYRTEDEKQKDTIQSKNALESYC 489 T S EK K IT+ K LS E+ ++ E + + + S+NAL + Sbjct: 407 TTSRAEKPLAKLGLITMFTSKADLSGITTEQKIHVDELVQHVSIRVDEGSSSENALSATN 466 Query: 488 FNMKSTMEDEK 456 T++DE+ Sbjct: 467 IVEAKTIDDEQ 477 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.6 bits (51), Expect = 7.9 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 551 RTEDEKQKDTIQSKNALESYCFNMKSTMEDEKLKDKITDS 432 +T +EK I+ N + C N+K M +KL + D+ Sbjct: 2376 KTFEEKCTRWIEGSNMILKACTNLKEEMMKQKLFSESADA 2415 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 862,704 Number of Sequences: 2352 Number of extensions: 12381 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 68 effective length of database: 404,043 effective search space used: 185455737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -