Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_F09_e646_11.seq
         (1567 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g07790.1 68418.m00892 expressed protein                             29   6.3  

>At5g07790.1 68418.m00892 expressed protein
          Length = 616

 Score = 29.5 bits (63), Expect = 6.3
 Identities = 22/67 (32%), Positives = 33/67 (49%)
 Frame = -1

Query: 409 RSRGARVKEPTAPISEIRMGFDVAPHRSGARLVKSLCLEPPDSRGSTVSISLPDSARLAS 230
           RSR +R K    P ++   G D  PH SG    +S   +    +GS+ S+S   SA+  +
Sbjct: 328 RSR-SRNKVKHCPSNKTFKGSDHDPHSSGQASSESQSNQTSMEKGSSSSLSEAKSAKKGT 386

Query: 229 ALEAFRH 209
           +L   RH
Sbjct: 387 SLGNKRH 393


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,752,792
Number of Sequences: 28952
Number of extensions: 409227
Number of successful extensions: 868
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 840
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 868
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4212064704
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)