BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F07_e630_11.seq (1583 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q27441 Cluster: Neuropeptide Y precursor [Contains: Neu... 44 0.008 UniRef50_UPI00003C0CFC Cluster: PREDICTED: hypothetical protein;... 40 0.24 >UniRef50_Q27441 Cluster: Neuropeptide Y precursor [Contains: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)]; n=1; Aplysia californica|Rep: Neuropeptide Y precursor [Contains: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] - Aplysia californica (California sea hare) Length = 92 Score = 44.4 bits (100), Expect = 0.008 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +1 Query: 217 PRRPERFDTAEQISNYLKELQXYYSVHGRGXYGKRQMHIRGR 342 P RPE F +A+Q+ YL L YYS+ GR +GKR R R Sbjct: 30 PPRPEEFTSAQQLRQYLAALNEYYSIMGRPRFGKRGDSFRKR 71 >UniRef50_UPI00003C0CFC Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 124 Score = 39.5 bits (88), Expect = 0.24 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 214 RPRRPERFDTAEQISNYLKELQXYYSVHGRGXYGKR 321 RP RPE F + E++ Y+ + YY + G+ YGKR Sbjct: 12 RPTRPEIFTSPEELRRYIDHVSDYYLLSGKARYGKR 47 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 910,239,875 Number of Sequences: 1657284 Number of extensions: 14537687 Number of successful extensions: 24459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24455 length of database: 575,637,011 effective HSP length: 104 effective length of database: 403,279,475 effective search space used: 170587217925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -