BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F07_e630_11.seq (1583 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 32 1.1 SB_16744| Best HMM Match : DUF1610 (HMM E-Value=1.6) 29 7.8 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 32.3 bits (70), Expect = 1.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 211 PRPRRPERFDTAEQISNYLKELQXYYSVH 297 P PRRP RF E I +L++ + Y S++ Sbjct: 117 PAPRRPRRFSGREDIRKFLRDFEIYVSLN 145 >SB_16744| Best HMM Match : DUF1610 (HMM E-Value=1.6) Length = 130 Score = 29.5 bits (63), Expect = 7.8 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 679 SKYMTIK-FKNNFIISILSNSYRLLNKISFYN 587 +KY T + F+ NFI S+L++ YR+ N YN Sbjct: 76 NKYTTPRCFQLNFIYSMLTDGYRVDNSFELYN 107 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,081,545 Number of Sequences: 59808 Number of extensions: 488519 Number of successful extensions: 700 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5188097434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -