BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F07_e630_11.seq (1583 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F pro... 27 2.0 >AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F protein. Length = 101 Score = 26.6 bits (56), Expect = 2.0 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 223 RPERFDTAEQIS--NYLKELQXYYSVHGRGXYGKR 321 RP+ D A + YL+EL+ ++ H R +GKR Sbjct: 31 RPQDSDAASVAAAIRYLQELETKHAQHARPRFGKR 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,000,054 Number of Sequences: 2352 Number of extensions: 16833 Number of successful extensions: 16 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 68 effective length of database: 404,043 effective search space used: 185455737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -