Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_F04_e606_12.seq
         (1600 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    26   0.79 
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    23   9.7  

>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 26.2 bits (55), Expect = 0.79
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -1

Query: 565 RRPSERNQCRSQM 527
           RRPS RN C SQM
Sbjct: 402 RRPSRRNSCESQM 414


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 22.6 bits (46), Expect = 9.7
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = -2

Query: 318 ELIDARLRHCQENVFNSTGAEWKIQKRLFTQNNIGQT 208
           EL++A L+  Q         E +IQK+  T N I +T
Sbjct: 766 ELVEAILKRVQTPFDPDVPIELQIQKQSHTPNGIVKT 802


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 290,081
Number of Sequences: 438
Number of extensions: 5347
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 61
effective length of database: 119,625
effective search space used: 56343375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)