BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F03_e598_11.seq (1567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 4.5 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 5.9 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.4 bits (53), Expect = 4.5 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 384 GVVSSGC-GTDLYRSSLRGTCCNRYGLLPAPQNSAAR 277 G GC D S +G+ CN+YG P N R Sbjct: 978 GFSEDGCHACDCDPSGSKGSQCNQYGQCPCNDNVEGR 1014 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 5.9 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 282 QLSSEALEAGRICCNKYLVKNCGKDQFHIRMRLH 383 +L+ E L G CN + K CGK HIR H Sbjct: 487 RLTFERLSGG---CNLHRCKLCGKVVTHIRNHYH 517 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 993,606 Number of Sequences: 2352 Number of extensions: 17615 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 184503330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -