BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F03_e598_11.seq (1567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 5.4 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 23 5.4 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.4 bits (48), Expect = 5.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 657 LRDAGRFANDGCNVKYRPEQWTPRCL 734 +RD +FAN G V R E +P L Sbjct: 96 IRDFSKFANRGLGVFERTEPLSPHLL 121 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 23.4 bits (48), Expect = 5.4 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -2 Query: 309 LLPAPQNSAARTHQTLSARIVGSHPLSLSFCPSRKYGSLG 190 L+ P + + H + A V + LSLS P +GS G Sbjct: 2 LVARPMQALSIRHAVILASFVWIYALSLSLPPLFGWGSYG 41 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 269,669 Number of Sequences: 438 Number of extensions: 5644 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 55027500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -