BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F02_e590_12.seq (1557 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 29 0.070 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 24 2.6 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 29.5 bits (63), Expect = 0.070 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -1 Query: 636 YSSKFCHSTKIYCLLVNHQPIDI*SFFGMNCP*FKILWHSKKKRKLFNTK 487 Y++K+CHS KI+ H P + G CP I H ++ T+ Sbjct: 294 YATKYCHSLKIHLRRYGHTPNVVLDEEGNPCPDIIIDVHGTRRGPKIKTQ 343 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 58 AAGNWHEGDEAYAQ 99 A G W+EG E Y+Q Sbjct: 101 AIGGWNEGSETYSQ 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,271 Number of Sequences: 336 Number of extensions: 5224 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46910650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -