BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_F02_e590_12.seq (1557 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 4.5 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 5.9 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.4 bits (53), Expect = 4.5 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 1551 GGXGXGXXGGXRGGVPRXXRPXGGGPPXPPXXRXXPXGGXRXGPXXPPPXFXGXPG 1384 G G G RG RP G P P R P G PP F G G Sbjct: 588 GPLGPQGEKGDRGDSGLMGRPGNDGLPGPQGQRGLPGPQGEKGDQG-PPGFIGPKG 642 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.0 bits (52), Expect = 5.9 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = -1 Query: 1527 GGXRGGVPRXXRP-XGGGPPXPPXXRXXPXGGXRXGPXXPP 1408 GG GG P+ RP P P P G G PP Sbjct: 306 GGAPGGPPQGMRPNFYNRPMGDPQTSRPPSGNDNMGGGPPP 346 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,185,724 Number of Sequences: 2352 Number of extensions: 20626 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 183284145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -