Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_E12_e669_10.seq
         (1517 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical pro...    23   7.8  

>AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical
           protein protein.
          Length = 205

 Score = 22.6 bits (46), Expect = 7.8
 Identities = 10/42 (23%), Positives = 19/42 (45%)
 Frame = -1

Query: 431 VIFISSSINLPSKTCV*RFIINNTFSVYYILSVFCFCMIFKN 306
           ++F +  +  P    V  +  +N F+V+      C C  +KN
Sbjct: 143 ILFFAQGLTSPIFNLVYVYCCDNNFNVFLRQVFTCRCKDYKN 184


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 257,644
Number of Sequences: 336
Number of extensions: 5106
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 45579125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)