BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_E08_e637_10.seq (1543 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 5.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 7.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 7.7 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.0 bits (52), Expect = 5.8 Identities = 14/63 (22%), Positives = 33/63 (52%) Frame = +3 Query: 180 KHPDLEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPA 359 K+ DL+K + A+++ R Y+ + +W++T++ EY+ IF+ + + Sbjct: 1134 KNCDLDKNQRNCIEFALKAKPIRRYIPKHRIQYKVWWFVTSQPFEYM-IFVLIMINTITL 1192 Query: 360 TLK 368 ++K Sbjct: 1193 SMK 1195 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 7.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 333 HLPPEIVPATLKRSVRTETVRRGAVGRPDAPARTAEDRSA 452 +LP I P L+ + RR A+G D P ++ + SA Sbjct: 455 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSSGNWSA 494 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 24.6 bits (51), Expect = 7.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 333 HLPPEIVPATLKRSVRTETVRRGAVGRPDAPARTAEDRSA 452 +LP I P L+ + RR A+G D P ++ + SA Sbjct: 456 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSSGNWSA 495 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,056,465 Number of Sequences: 2352 Number of extensions: 18313 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 181252170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -