BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_E07_e629_09.seq (1580 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) 75 2e-13 >SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) Length = 166 Score = 74.9 bits (176), Expect = 2e-13 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +3 Query: 204 PNLQVIKAMQSLKSXGYVKEQFAWRHFYWYLTNEGIEYLKNF 329 PNL VIKA+QSLKS GYV+E+F W+H+YW LTNEGI YL++F Sbjct: 39 PNLHVIKALQSLKSRGYVEEKFCWKHYYWNLTNEGITYLRDF 80 Score = 61.7 bits (143), Expect = 2e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 89 MLMPKQNRVSIYEYLFXEGVMVAKKDYHAPKHPDLEKXP 205 ML+PK+NRV IYEYLF EGV VAKKD+++PKH +E P Sbjct: 1 MLIPKKNRVIIYEYLFKEGVCVAKKDFNSPKHTQIENVP 39 Score = 39.1 bits (87), Expect = 0.010 Identities = 20/27 (74%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = +1 Query: 319 LRIFLHLPPEIVPATLKRSV-RTETVR 396 LR FLHLP EIVPATL+R V R ET R Sbjct: 77 LRDFLHLPTEIVPATLRRQVTRAETAR 103 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,799,097 Number of Sequences: 59808 Number of extensions: 469230 Number of successful extensions: 1028 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5176359657 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -