BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_E04_e605_10.seq (1528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 2.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 2.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 6.0 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +3 Query: 405 THPIKNELQRIKATMMKWQQVKDHDKRPQVDREAVKRFIRSGL 533 T P+ + Q + KW D + P V E + +I G+ Sbjct: 15 TEPLYSSTQMPEKVREKWNVFDDPPREPTVGSEVKRTYIEWGV 57 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +3 Query: 405 THPIKNELQRIKATMMKWQQVKDHDKRPQVDREAVKRFIRSGL 533 T P+ + Q + KW D + P V E + +I G+ Sbjct: 15 TEPLYSSTQMPEKVREKWNVFDDPPREPTVGSEVKRTYIEWGV 57 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.0 bits (47), Expect = 6.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 120 IYLSRFKMKENISKSVIKW 176 I+L +KEN +VIKW Sbjct: 166 IFLQNLILKENTYDAVIKW 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 276,692 Number of Sequences: 336 Number of extensions: 5244 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45886400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -