BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_E03_e597_09.seq (1535 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15E1.03 |rpl36a||60S ribosomal protein L36/L42|Schizosacchar... 122 1e-28 SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity fac... 27 6.9 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 9.1 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 9.1 >SPAC15E1.03 |rpl36a||60S ribosomal protein L36/L42|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 122 bits (294), Expect = 1e-28 Identities = 56/106 (52%), Positives = 69/106 (65%), Gaps = 2/106 (1%) Frame = +3 Query: 93 MVNVPKQRRTY--XXXXXXXXXXXXSQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIFXX 266 MVN+PK R+TY +QYKK + AQG+RRYDRKQ G+GGQ+KP+F Sbjct: 1 MVNIPKTRKTYCPGKNCRKHTVHRVTQYKKGPDSKLAQGKRRYDRKQSGFGGQTKPVFHK 60 Query: 267 XXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 404 +VLRLEC CK ++Q+ LKRCKHFELGG+KK KG IQF Sbjct: 61 KAKVTKKVVLRLECVSCKYKNQLVLKRCKHFELGGEKKTKGAAIQF 106 >SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity factor complex subunit, Fip1 homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 387 PSSSCHHQAQSAYNASGPPVTSPCSLHIP 301 P+SS + A + YNAS PP P S + P Sbjct: 287 PTSSYGNGASTNYNASRPPSNHPHSSNYP 315 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 9.1 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +1 Query: 472 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 636 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 637 SCA 645 S A Sbjct: 232 SDA 234 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 579 PPFASWRNSEEARTDRPSQQLRSLN 653 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,112,719 Number of Sequences: 5004 Number of extensions: 69997 Number of successful extensions: 121 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 862245690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -