BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_E01_e581_09.seq (1504 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 28 0.61 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 9.9 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 28.3 bits (60), Expect = 0.61 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -1 Query: 784 LRNCWXGRSVRASSLLRQLAKRGMCCKAIKLGNARVFPVTTL*ND 650 LRN + G++V + LLR + +A KL N VFP T N+ Sbjct: 203 LRNDFEGQAVLINCLLRNYLHYSLYDQADKLVNKSVFPETASNNE 247 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 9.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 216 SQPGASRYPFLTRQRLPCCCDIPVEIN 136 S PG S+ P L R+ P C + +I+ Sbjct: 1147 SGPGGSKTPILNRKEKPKSCSVCRQIS 1173 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,179,812 Number of Sequences: 2352 Number of extensions: 22813 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 175969035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -