BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D11_e660_07.seq (1557 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.08 |||CDK regulator |Schizosaccharomyces pombe|chr 3|||M... 29 1.3 SPAC13C5.05c |||N-acetylglucosamine-phosphate mutase |Schizosacc... 28 4.0 >SPCC613.08 |||CDK regulator |Schizosaccharomyces pombe|chr 3|||Manual Length = 325 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 290 NFKLVKSVFVNGSFRHFDPQAILWHYFR 207 + K+V + F+N F FDPQ I +H F+ Sbjct: 60 SLKVVDTDFINVDFEFFDPQPIDFHAFK 87 >SPAC13C5.05c |||N-acetylglucosamine-phosphate mutase |Schizosaccharomyces pombe|chr 1|||Manual Length = 518 Score = 27.9 bits (59), Expect = 4.0 Identities = 21/80 (26%), Positives = 38/80 (47%) Frame = +3 Query: 192 WDNCYTEIVPKDRLRVKVTKTPIDKNTFHKFEIAVPDDLKDYAKVENAHKEFQKVIGAAL 371 W N Y ++ P +VKV+ I K+T + + PD L++ K++ +++K G + Sbjct: 430 WSNTYKDL-PNKLAKVKVSDRTIYKSTDAERRLVSPDGLQE--KIDALVAKYEK--GRSF 484 Query: 372 VWYVPERAVLAVISRCDTSQ 431 V V+ V + T Q Sbjct: 485 VRASGTEDVVRVYAEASTKQ 504 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,066,571 Number of Sequences: 5004 Number of extensions: 67987 Number of successful extensions: 153 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 876120908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -