BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D11_e660_07.seq (1557 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0313 + 33073542-33074464,33074901-33075069 29 9.9 02_01_0413 - 3028946-3031111 29 9.9 >03_06_0313 + 33073542-33074464,33074901-33075069 Length = 363 Score = 29.1 bits (62), Expect = 9.9 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -3 Query: 496 KSIIRVSLVDARCTRQVRLARFCEVSQREMTASTARSGTYQTSAAPITFWNSLCA 332 K +I S ++ CT + F +S + ++ S A + + +AAP T S CA Sbjct: 202 KEVISFSFDNSVCTSSAATSFFTSISSQLISMSDAATNSAAAAAAPTTKKPSSCA 256 >02_01_0413 - 3028946-3031111 Length = 721 Score = 29.1 bits (62), Expect = 9.9 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +3 Query: 177 IEYLEWDNCYTEIVPKDRLRVKVTKTPIDKNTFHKFEIAVPDDLKDYAKVENAHKEFQKV 356 +EYL + N + + + D L +K++ ++F +PD + ++E H E + Sbjct: 255 LEYLSFPNNHLQGIIDDALMIKLSNLGFLDLGGNRFSGKIPDSIGQLKRLEELHMEENNI 314 Query: 357 IG 362 G Sbjct: 315 SG 316 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,145,355 Number of Sequences: 37544 Number of extensions: 542896 Number of successful extensions: 1246 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1245 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5023712764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -