BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D11_e660_07.seq (1557 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003138-1|AAK21371.3| 469|Caenorhabditis elegans Hypothetical ... 30 5.1 Z73905-3|CAA98111.3| 357|Caenorhabditis elegans Hypothetical pr... 29 8.9 >AF003138-1|AAK21371.3| 469|Caenorhabditis elegans Hypothetical protein F12B6.3 protein. Length = 469 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 185 ILYHKEFTPYHLDISSPPP 129 + Y K F PYH D+SSPPP Sbjct: 342 VSYLKHFEPYH-DVSSPPP 359 >Z73905-3|CAA98111.3| 357|Caenorhabditis elegans Hypothetical protein C32C4.3 protein. Length = 357 Score = 29.1 bits (62), Expect = 8.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 524 SGIQITNLL*KHNTSKSSRCTMHAAGASRALLRGVAAR 411 SG+QI +L + S +C + G ++ALLRG R Sbjct: 94 SGLQIESLSFEKQLSVMQKCNLKTRGINQALLRGKVIR 131 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,734,721 Number of Sequences: 27780 Number of extensions: 424668 Number of successful extensions: 927 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4494062834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -