Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_D11_e660_07.seq
         (1557 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    23   9.4  

>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 22.6 bits (46), Expect = 9.4
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = -2

Query: 644 LYRVSGRCRSPSVTVGHRRATRIASVSDVHMF 549
           L R+SG     SVT G R  T +A + D+H +
Sbjct: 140 LVRLSG---DGSVTYGMRFTTTLACMMDLHYY 168


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 294,708
Number of Sequences: 438
Number of extensions: 5955
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 61
effective length of database: 119,625
effective search space used: 54668625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)