BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D11_e660_07.seq (1557 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12840.1 68414.m01491 vacuolar ATP synthase subunit C (VATC) ... 29 6.3 >At1g12840.1 68414.m01491 vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / vacuolar proton pump C subunit (DET3) identical to vacuolar ATP synthase subunit C SP:Q9SDS7 from [Arabidopsis thaliana] Length = 375 Score = 29.5 bits (63), Expect = 6.3 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = -3 Query: 565 ATYTCLIFSYLSNNQEYKSRISYKSIIRVSL-VDARCTRQVRLARFCEVSQREMTASTAR 389 A YT +F+ +++N +R + V+A+ TR+ LA+ V +E S+ Sbjct: 222 ALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEAQETRKQELAKL--VQDQESLRSSLL 279 Query: 388 SGTYQTSAAPITFWNSLCAFSTFA*SLRSSG 296 Y + + W CA TFA S+ G Sbjct: 280 QWCYTSYGEVFSSWMHFCAVRTFAESIMRYG 310 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,436,812 Number of Sequences: 28952 Number of extensions: 394622 Number of successful extensions: 896 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4183148928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -