BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D08_e636_08.seq (1514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 83 6e-16 SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) 48 2e-05 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 45 2e-04 SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 39 0.009 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.012 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 38 0.028 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.037 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 37 0.049 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 37 0.049 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.085 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.20 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.20 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.26 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 34 0.26 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.34 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.34 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.34 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.34 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.34 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 33 0.45 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 33 0.60 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 33 0.60 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 33 0.79 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 33 0.79 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 33 0.79 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 33 0.79 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 33 0.79 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 33 0.79 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 33 0.79 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 33 0.79 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 33 0.79 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.79 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 32 1.0 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 32 1.0 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 32 1.0 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 32 1.4 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 32 1.4 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 32 1.4 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 32 1.4 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.4 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 31 1.8 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 31 2.4 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 31 2.4 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) 31 2.4 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 31 2.4 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 31 2.4 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 31 2.4 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 3.2 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 3.2 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 31 3.2 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 30 4.2 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) 30 4.2 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) 30 4.2 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 30 4.2 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 30 4.2 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_58201| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) 30 4.2 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 30 4.2 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 30 4.2 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 30 4.2 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) 30 4.2 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 30 5.6 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 30 5.6 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 30 5.6 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 30 5.6 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 30 5.6 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 30 5.6 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 30 5.6 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 30 5.6 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 30 5.6 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 30 5.6 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 30 5.6 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 30 5.6 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 30 5.6 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 30 5.6 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 30 5.6 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 29 7.4 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 29 7.4 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 7.4 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 29 7.4 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 29 7.4 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 29 7.4 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 29 7.4 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 29 7.4 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 29 7.4 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 29 7.4 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 7.4 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 29 7.4 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 7.4 SB_12826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 29 7.4 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 29 9.7 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 29 9.7 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 29 9.7 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 29 9.7 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 83.0 bits (196), Expect = 6e-16 Identities = 41/90 (45%), Positives = 60/90 (66%), Gaps = 1/90 (1%) Frame = +3 Query: 288 DMFSEKDDFELNSLNEKVNTNKEXSLQLTDNWDDVEGYYRINIGELINKKYTIKDTLGQG 467 DMFSE N++ K+++ KE LTDNWDD +GYYR+ IGEL++K+Y + G G Sbjct: 615 DMFSEHYSSPANAMM-KIDSTKENP-NLTDNWDDADGYYRVRIGELLDKRYNVYGFSGSG 672 Query: 468 VFANVARAQDN-QENXIVAIKIIRNXXLLY 554 VF+NV RA+D + + V +KIIRN +++ Sbjct: 673 VFSNVVRARDQARGSQEVVVKIIRNNEMMH 702 Score = 33.5 bits (73), Expect = 0.45 Identities = 21/88 (23%), Positives = 32/88 (36%) Frame = +1 Query: 559 TGLXEXAILKEICXADPENXXHXXXXIXHFLXXGPLCXVXSXFLWXCDVYLRNMAKSWNS 738 TGL E LK++ ADP++ H HF LC V LR ++ Sbjct: 704 TGLKELEFLKKLNDADPDDKYHCLRLYRHFFHKNHLCLVFESLHMNLREVLRKYGQNVGL 763 Query: 739 FXSIIRYCRPPIX*LXXVFEKLGXFRAD 822 +R + + ++ G AD Sbjct: 764 HIKAVRSYSQQLFLALKLMKRTGILHAD 791 >SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) Length = 892 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/63 (36%), Positives = 35/63 (55%) Frame = +3 Query: 351 KEXSLQLTDNWDDVEGYYRINIGELINKKYTIKDTLGQGVFANVARAQDNQENXIVAIKI 530 K+ Q D +DD Y + GE +Y I+ +G+G F V +A D+QE +A+KI Sbjct: 359 KKRPPQYNDGYDDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKI 418 Query: 531 IRN 539 I+N Sbjct: 419 IKN 421 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 44.8 bits (101), Expect = 2e-04 Identities = 24/73 (32%), Positives = 40/73 (54%) Frame = +3 Query: 321 NSLNEKVNTNKEXSLQLTDNWDDVEGYYRINIGELINKKYTIKDTLGQGVFANVARAQDN 500 N + +V+ N + Q N GY+ + +G+L N +Y++ LG G F+ V A D Sbjct: 20 NEDDYEVDENSDDEEQEDPNDYCKGGYHPVQLGDLFNNRYSVIRKLGWGHFSTVWLAWDV 79 Query: 501 QENXIVAIKIIRN 539 EN VA+KI+++ Sbjct: 80 SENKYVALKIVKS 92 >SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 43.2 bits (97), Expect = 6e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +3 Query: 375 DNWDDVEGYYRINIGELINKKYTIKDTLGQGVFANVARAQDNQENXIVAIKIIRN 539 +N+DD G Y + + + +Y + + LG+G F V +A D++ VA+KIIRN Sbjct: 266 NNYDDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRN 320 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQELN--QLGFRRRRSYY*TNKKTTETIIRK 150 ALELVDPPGCRNS + + QQ +++ L R+R TN+K + ++++ Sbjct: 12 ALELVDPPGCRNSIK-RTQQQLDDIHDKMLDMRKRVFELETNEKCMQQLLQE 62 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKN 54 ALELVDPPGCRNS GKN Sbjct: 88 ALELVDPPGCRNSIAGKN 105 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 37.5 bits (83), Expect = 0.028 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQELNQLGF 90 ALELVDPPGCRNS + K ++ E+ + F Sbjct: 12 ALELVDPPGCRNSIKDKGEKESMEIVHVKF 41 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.1 bits (82), Expect = 0.037 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQELNQLGFRRRRSYY*TNKKTTETIIRKISSH 162 ALELVDPPGCRNS G + + R+S K + I+ K++ H Sbjct: 29 ALELVDPPGCRNSIDGNGVSDGDGGSGDNDNHRKSDSSAIKSSQTEIVEKMADH 82 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 36.7 bits (81), Expect = 0.049 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQELNQLGFRRRRS 105 ALELVDPPGCRNS N ++ +E + RS Sbjct: 656 ALELVDPPGCRNSISSSNQRKIKEKKAPNLQEVRS 690 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 36.7 bits (81), Expect = 0.049 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQELNQLGFRR 96 ALELVDPPGCRNS R + L++ G RR Sbjct: 12 ALELVDPPGCRNSIRTVAQLLVEALHRRGTRR 43 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 35.9 bits (79), Expect = 0.085 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKN 54 ALELVDPPGCRNS G N Sbjct: 12 ALELVDPPGCRNSIEGCN 29 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 34.7 bits (76), Expect = 0.20 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQE 72 ALELVDPPGCRNS L Y++ Sbjct: 12 ALELVDPPGCRNSILLTELADYEK 35 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 34.7 bits (76), Expect = 0.20 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQY 66 ALELVDPPGCRNS + +++ + Sbjct: 12 ALELVDPPGCRNSIQARSVDGF 33 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 1 ALELVDPPGCRNSXR 45 ALELVDPPGCRNS R Sbjct: 12 ALELVDPPGCRNSIR 26 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 1 ALELVDPPGCRNSXRG 48 ALELVDPPGCRNS G Sbjct: 99 ALELVDPPGCRNSITG 114 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQY 66 ALELVDPPGCRNS G +++ Sbjct: 12 ALELVDPPGCRNSMIGSGGREH 33 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQE 72 ALELVDPPGCRNS +++Q E Sbjct: 12 ALELVDPPGCRNSIDINDMKQLFE 35 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQELNQL 84 ALELVDPPGCRNS Q+ + +L Sbjct: 12 ALELVDPPGCRNSIAADANQESENAEKL 39 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 73 ILDIAGDFSLVXNSCSPGDPLVL 5 +L I G F NSCSPGDPLVL Sbjct: 2 VLRIVGLFYSASNSCSPGDPLVL 24 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGK 51 ALELVDPPGCRNS + K Sbjct: 12 ALELVDPPGCRNSMKMK 28 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQY 66 ALELVDPPGCRNS K + + Sbjct: 12 ALELVDPPGCRNSMLPKRTEGF 33 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 33.5 bits (73), Expect = 0.45 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQELNQ 81 ALELVDPPGCRNS G+N Y Q Sbjct: 12 ALELVDPPGCRNSI-GQNGFTYMNNRQ 37 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNL 57 ALELVDPPGCRNS N+ Sbjct: 12 ALELVDPPGCRNSIEDFNV 30 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F L+ NSCSPGDPLVL Sbjct: 22 FPLISNSCSPGDPLVL 37 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQ 63 ALELVDPPGCRNS L + Sbjct: 12 ALELVDPPGCRNSMVASELME 32 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQEL 75 ALELVDPPGCRNS + EL Sbjct: 12 ALELVDPPGCRNSITKDKMYGRNEL 36 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 1 ALELVDPPGCRNSXR 45 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSMK 26 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 PR EFLQPGGSTSSR Sbjct: 40 PRIEFLQPGGSTSSR 54 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNL 57 ALELVDPPGCRNS L Sbjct: 29 ALELVDPPGCRNSIMDSGL 47 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 1 ALELVDPPGCRNSXR 45 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSIK 26 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 1 ALELVDPPGCRNSXR 45 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSMK 26 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 1 ALELVDPPGCRNSXR 45 ALELVDPPGCRNS + Sbjct: 67 ALELVDPPGCRNSMK 81 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 1 ALELVDPPGCRNSXR 45 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSIK 26 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 WRFFPRXEFLQPGGSTSSR 3 +R+ R EFLQPGGSTSSR Sbjct: 19 FRYIHRIEFLQPGGSTSSR 37 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +1 Query: 1 ALELVDPPGCRNSXRGKNLQQYQE 72 ALELVDPPGCRNS +++ + E Sbjct: 49 ALELVDPPGCRNSINIESVNRRTE 72 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 33 SLISNSCSPGDPLVL 47 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -2 Query: 76 SILDIAGDFSLVXNSCSPGDPLVL 5 S+L + LV NSCSPGDPLVL Sbjct: 16 SVLALKSRPMLVSNSCSPGDPLVL 39 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 70 LDIAGDFSLVXNSCSPGDPLVL 5 +D+ + V NSCSPGDPLVL Sbjct: 18 IDVVPFYCYVSNSCSPGDPLVL 39 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 32 SLISNSCSPGDPLVL 46 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL+ NSCSPGDPLVL Sbjct: 30 SLISNSCSPGDPLVL 44 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S+V NSCSPGDPLVL Sbjct: 346 SIVSNSCSPGDPLVL 360 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F ++ NSCSPGDPLVL Sbjct: 15 FRIISNSCSPGDPLVL 30 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 32.7 bits (71), Expect = 0.79 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +3 Query: 393 EGYYRINIGELI---NKKYTIKDTLGQGVFANVARAQDNQENXIVAIKIIRN 539 EG Y++ + E + +Y + + LG+G F V + N +VAIKI+++ Sbjct: 80 EGDYKVVLHEELCSATSRYEVLEFLGRGTFGQVVKCWKKGTNELVAIKILKD 131 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 32 ALELVDPPGCRNS 44 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 56 RFFPRXEFLQPGGSTSSR 3 R+ P EFLQPGGSTSSR Sbjct: 143 RYGPAIEFLQPGGSTSSR 160 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 88 ALELVDPPGCRNS 100 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 70 LDIAGDFSLVXNSCSPGDPLVL 5 LD D NSCSPGDPLVL Sbjct: 29 LDFQNDCFYTSNSCSPGDPLVL 50 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 61 AGDFSLVXNSCSPGDPLVL 5 A D + V NSCSPGDPLVL Sbjct: 111 ASDTNEVSNSCSPGDPLVL 129 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 69 ALELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 58 GDFSLVXNSCSPGDPLVL 5 G + + NSCSPGDPLVL Sbjct: 18 GSYEVTSNSCSPGDPLVL 35 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 99 ALELVDPPGCRNS 111 >SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 53 FFPRXEFLQPGGSTSSR 3 ++P EFLQPGGSTSSR Sbjct: 24 YWPEIEFLQPGGSTSSR 40 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 ALELVDPPGCRNS 39 ALELVDPPGCRNS Sbjct: 75 ALELVDPPGCRNS 87 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 F R EFLQPGGSTSSR Sbjct: 48 FSRIEFLQPGGSTSSR 63 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 +A F + NSCSPGDPLVL Sbjct: 46 LAEGFRVASNSCSPGDPLVL 65 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -2 Query: 67 DIAGDFSL-VXNSCSPGDPLVL 5 +I G+F + NSCSPGDPLVL Sbjct: 12 NITGEFQWQISNSCSPGDPLVL 33 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 61 AGDFSLVXNSCSPGDPLVL 5 AG ++ + NSCSPGDPLVL Sbjct: 12 AGLWASISNSCSPGDPLVL 30 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 73 ILDIAGDFSLVXNSCSPGDPLVL 5 I+ G++ NSCSPGDPLVL Sbjct: 9 IVQELGEYLTASNSCSPGDPLVL 31 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Frame = -2 Query: 61 AGD-FSLVXNSCSPGDPLVL 5 AGD + + NSCSPGDPLVL Sbjct: 45 AGDVIAFISNSCSPGDPLVL 64 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 67 DIAGDFSLVXNSCSPGDPLVL 5 D GD NSCSPGDPLVL Sbjct: 89 DALGDAQPPSNSCSPGDPLVL 109 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 +P EFLQPGGSTSSR Sbjct: 32 YPNIEFLQPGGSTSSR 47 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 73 ILDIAGDFSLVXNSCSPGDPLVL 5 I I L NSCSPGDPLVL Sbjct: 652 IFAILNSLQLASNSCSPGDPLVL 674 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 LV NSCSPGDPLVL Sbjct: 24 LVSNSCSPGDPLVL 37 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 LV NSCSPGDPLVL Sbjct: 3 LVSNSCSPGDPLVL 16 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 55 DFSLVXNSCSPGDPLVL 5 D S NSCSPGDPLVL Sbjct: 30 DISKTSNSCSPGDPLVL 46 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 LV NSCSPGDPLVL Sbjct: 17 LVSNSCSPGDPLVL 30 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 LV NSCSPGDPLVL Sbjct: 9 LVSNSCSPGDPLVL 22 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P+ EFLQPGGSTSSR Sbjct: 50 PKIEFLQPGGSTSSR 64 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 + G+ V NSCSPGDPLVL Sbjct: 57 LPGNLRPVSNSCSPGDPLVL 76 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P+ EFLQPGGSTSSR Sbjct: 6 PKIEFLQPGGSTSSR 20 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 LV NSCSPGDPLVL Sbjct: 5 LVSNSCSPGDPLVL 18 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 LV NSCSPGDPLVL Sbjct: 2 LVSNSCSPGDPLVL 15 >SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 79 GSILDIAGDFSLVXNSCSPGDPLVL 5 G + ++G + NSCSPGDPLVL Sbjct: 2 GRGVQVSGTHMMGSNSCSPGDPLVL 26 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S V NSCSPGDPLVL Sbjct: 12 SFVSNSCSPGDPLVL 26 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 LV NSCSPGDPLVL Sbjct: 26 LVSNSCSPGDPLVL 39 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL NSCSPGDPLVL Sbjct: 14 SLTSNSCSPGDPLVL 28 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +3 Query: 408 INIGELINKKYTIKDTLGQGVFANVARAQDNQENXIVAIKII 533 I G N+KY +K+ LG+G F+ V + + A+KI+ Sbjct: 7 ITEGGTFNEKYELKEELGKGAFSTVRKCCHRETKIEYAVKIL 48 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 I+ + S NSCSPGDPLVL Sbjct: 9 ISANISQTSNSCSPGDPLVL 28 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 17 LISNSCSPGDPLVL 30 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 +P EFLQPGGSTSSR Sbjct: 112 YPGIEFLQPGGSTSSR 127 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 432 KKYTIKDTLGQGVFANVARAQDNQENXIVAIKII 533 K ++ + +G+G F V + DN+ N +VAIKII Sbjct: 810 KLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKII 843 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 58 GDFSLVXNSCSPGDPLVL 5 G F+ NSCSPGDPLVL Sbjct: 136 GHFAPSSNSCSPGDPLVL 153 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 37 LISNSCSPGDPLVL 50 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 58 GDFSLVXNSCSPGDPLVL 5 G S NSCSPGDPLVL Sbjct: 6 GSLSYQSNSCSPGDPLVL 23 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 ++V NSCSPGDPLVL Sbjct: 76 TIVSNSCSPGDPLVL 90 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 67 DIAGDFSLVXNSCSPGDPLVL 5 D+ G+ NSCSPGDPLVL Sbjct: 6 DLKGEAVSSSNSCSPGDPLVL 26 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 8 LISNSCSPGDPLVL 21 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 56 RFFPRXEFLQPGGSTSSR 3 ++ P EFLQPGGSTSSR Sbjct: 25 QYNPEIEFLQPGGSTSSR 42 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 40 LISNSCSPGDPLVL 53 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 70 LISNSCSPGDPLVL 83 >SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 +P EFLQPGGSTSSR Sbjct: 18 YPDIEFLQPGGSTSSR 33 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 DFSLVXNSCSPGDPLVL 5 D + NSCSPGDPLVL Sbjct: 17 DLTFTSNSCSPGDPLVL 33 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 61 AGDFSLVXNSCSPGDPLVL 5 A + L NSCSPGDPLVL Sbjct: 83 ASNLLLTSNSCSPGDPLVL 101 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 ++V NSCSPGDPLVL Sbjct: 12 NIVSNSCSPGDPLVL 26 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 21 LISNSCSPGDPLVL 34 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 16 LISNSCSPGDPLVL 29 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F + NSCSPGDPLVL Sbjct: 33 FGFLSNSCSPGDPLVL 48 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 +A + L NSCSPGDPLVL Sbjct: 5 MAHESGLTSNSCSPGDPLVL 24 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 109 PNIEFLQPGGSTSSR 123 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 9 PNIEFLQPGGSTSSR 23 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S V NSCSPGDPLVL Sbjct: 13 SQVSNSCSPGDPLVL 27 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 +P EFLQPGGSTSSR Sbjct: 21 YPCIEFLQPGGSTSSR 36 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +L+ NSCSPGDPLVL Sbjct: 61 TLLSNSCSPGDPLVL 75 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F + NSCSPGDPLVL Sbjct: 15 FRVTSNSCSPGDPLVL 30 >SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) Length = 177 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -1 Query: 62 CWRF-FPRXEFLQPGGSTSSR 3 C+R F EFLQPGGSTSSR Sbjct: 144 CYRAEFEAIEFLQPGGSTSSR 164 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL NSCSPGDPLVL Sbjct: 3 SLSSNSCSPGDPLVL 17 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 6 RTSGSPGLQEFXTREKSPAI 65 RTSGSPGLQEF R + P + Sbjct: 13 RTSGSPGLQEFDKRAECPEL 32 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +++ NSCSPGDPLVL Sbjct: 12 NIISNSCSPGDPLVL 26 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +L+ NSCSPGDPLVL Sbjct: 1 TLLSNSCSPGDPLVL 15 >SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -1 Query: 65 YCWRFFPRXEFLQPGGSTSSR 3 +C F EFLQPGGSTSSR Sbjct: 53 FCSSKFLAIEFLQPGGSTSSR 73 >SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 58 GDFSLVXNSCSPGDPLVL 5 G F NSCSPGDPLVL Sbjct: 7 GTFGNSSNSCSPGDPLVL 24 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 11 MVSNSCSPGDPLVL 24 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S+ NSCSPGDPLVL Sbjct: 33 SITSNSCSPGDPLVL 47 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 3 PEIEFLQPGGSTSSR 17 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 1 MVSNSCSPGDPLVL 14 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 ++V NSCSPGDPLVL Sbjct: 18 TVVSNSCSPGDPLVL 32 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 SL NSCSPGDPLVL Sbjct: 5 SLSSNSCSPGDPLVL 19 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 55 PNIEFLQPGGSTSSR 69 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 85 IVSNSCSPGDPLVL 98 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S V NSCSPGDPLVL Sbjct: 15 SKVSNSCSPGDPLVL 29 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 +S+ NSCSPGDPLVL Sbjct: 5 WSVTSNSCSPGDPLVL 20 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +++ NSCSPGDPLVL Sbjct: 3 TIISNSCSPGDPLVL 17 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 6 IVSNSCSPGDPLVL 19 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 + R EFLQPGGSTSSR Sbjct: 23 YARIEFLQPGGSTSSR 38 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 1 MVSNSCSPGDPLVL 14 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F L NSCSPGDPLVL Sbjct: 20 FLLPSNSCSPGDPLVL 35 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +++ NSCSPGDPLVL Sbjct: 12 NIISNSCSPGDPLVL 26 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -2 Query: 70 LDIAGDFSLVXNSCSPGDPLVL 5 +D DF V NSCSPGDPLVL Sbjct: 10 VDKIADF--VSNSCSPGDPLVL 29 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S+ NSCSPGDPLVL Sbjct: 18 SITSNSCSPGDPLVL 32 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 I+ + NSCSPGDPLVL Sbjct: 9 ISANICFTSNSCSPGDPLVL 28 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 23 PSIEFLQPGGSTSSR 37 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 F + EFLQPGGSTSSR Sbjct: 91 FGKIEFLQPGGSTSSR 106 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 23 PMIEFLQPGGSTSSR 37 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.7 bits (66), Expect = 3.2 Identities = 28/112 (25%), Positives = 30/112 (26%), Gaps = 5/112 (4%) Frame = +3 Query: 1146 LAXNXXXSVYXPXXPXLXXXPXXGNLPLYXXXXXGRGXXSX*PXHXLGXLPXXGTXXGGR 1325 LA + P P P GN P + P G P G Sbjct: 156 LAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGP 215 Query: 1326 P-----XXPLXXXRXTXPXSSLRXXPLPPGXPXLXPSPPXXGXXXXGRPPXP 1466 P P P S R P PP P PP G G PP P Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGEN-RPPPPMRGPTSGGEPPPP 266 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 53 FFPRXEFLQPGGSTSSR 3 F R EFLQPGGSTSSR Sbjct: 2 FAIRIEFLQPGGSTSSR 18 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +L NSCSPGDPLVL Sbjct: 14 ALTSNSCSPGDPLVL 28 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 ++ NSCSPGDPLVL Sbjct: 119 IISNSCSPGDPLVL 132 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S + NSCSPGDPLVL Sbjct: 57 SSISNSCSPGDPLVL 71 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 +AG + NSCSPGDPLVL Sbjct: 1 MAGRRLFLSNSCSPGDPLVL 20 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F NSCSPGDPLVL Sbjct: 5 FQATSNSCSPGDPLVL 20 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.7 bits (66), Expect = 3.2 Identities = 28/112 (25%), Positives = 30/112 (26%), Gaps = 5/112 (4%) Frame = +3 Query: 1146 LAXNXXXSVYXPXXPXLXXXPXXGNLPLYXXXXXGRGXXSX*PXHXLGXLPXXGTXXGGR 1325 LA + P P P GN P + P G P G Sbjct: 68 LAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGP 127 Query: 1326 P-----XXPLXXXRXTXPXSSLRXXPLPPGXPXLXPSPPXXGXXXXGRPPXP 1466 P P P S R P PP P PP G G PP P Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGEN-RPPPPMRGPTSGGEPPPP 178 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 3474 VVSNSCSPGDPLVL 3487 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S + NSCSPGDPLVL Sbjct: 2 SQISNSCSPGDPLVL 16 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 ++ NSCSPGDPLVL Sbjct: 14 IISNSCSPGDPLVL 27 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +L NSCSPGDPLVL Sbjct: 5 TLASNSCSPGDPLVL 19 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 76 SILDIAGDFSLVXNSCSPGDPLVL 5 SI+ + +S NSCSPGDPLVL Sbjct: 9 SIICNSLSYSFRSNSCSPGDPLVL 32 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 7 VVSNSCSPGDPLVL 20 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 54 LLSNSCSPGDPLVL 67 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 + V NSCSPGDPLVL Sbjct: 17 AFVSNSCSPGDPLVL 31 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 67 DIAGDFSLVXNSCSPGDPLVL 5 +I +S NSCSPGDPLVL Sbjct: 103 NIPDHYSSPSNSCSPGDPLVL 123 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 58 GDFSLVXNSCSPGDPLVL 5 G + NSCSPGDPLVL Sbjct: 22 GAYGKTSNSCSPGDPLVL 39 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 6 LLSNSCSPGDPLVL 19 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 Query: 61 AGDFSLVXNSCSPGDPLVL 5 A +++ NSCSPGDPLVL Sbjct: 29 AKPYNIPSNSCSPGDPLVL 47 >SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 56 RFFPRXEFLQPGGSTSSR 3 R+F EFLQPGGSTSSR Sbjct: 18 RWFIIIEFLQPGGSTSSR 35 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 ++ NSCSPGDPLVL Sbjct: 5 IISNSCSPGDPLVL 18 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 53 FFPRXEFLQPGGSTSSR 3 + P EFLQPGGSTSSR Sbjct: 22 YTPPIEFLQPGGSTSSR 38 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F + NSCSPGDPLVL Sbjct: 2 FYSISNSCSPGDPLVL 17 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +++ NSCSPGDPLVL Sbjct: 4 NVISNSCSPGDPLVL 18 >SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 71 PTIEFLQPGGSTSSR 85 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 13 PTIEFLQPGGSTSSR 27 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 ++ NSCSPGDPLVL Sbjct: 1 MISNSCSPGDPLVL 14 >SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 53 FFPRXEFLQPGGSTSSR 3 F+ EFLQPGGSTSSR Sbjct: 2 FYLNIEFLQPGGSTSSR 18 >SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 62 CWRFFPRXEFLQPGGSTSSR 3 C + EFLQPGGSTSSR Sbjct: 41 CHNYTGNIEFLQPGGSTSSR 60 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 1 LLSNSCSPGDPLVL 14 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L+ NSCSPGDPLVL Sbjct: 7 LLSNSCSPGDPLVL 20 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +L NSCSPGDPLVL Sbjct: 2 TLASNSCSPGDPLVL 16 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 +V NSCSPGDPLVL Sbjct: 27 VVSNSCSPGDPLVL 40 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S + NSCSPGDPLVL Sbjct: 4 SKISNSCSPGDPLVL 18 >SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 52 FSLVXNSCSPGDPLVL 5 F++ NSCSPGDPLVL Sbjct: 2 FNVGSNSCSPGDPLVL 17 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 ++ NSCSPGDPLVL Sbjct: 26 IISNSCSPGDPLVL 39 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +L NSCSPGDPLVL Sbjct: 95 ALASNSCSPGDPLVL 109 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 30 VSNSCSPGDPLVL 42 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 16 RIEFLQPGGSTSSR 29 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 19 RIEFLQPGGSTSSR 32 >SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) Length = 1452 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 456 LGQGVFANVARAQDNQENXIVAIKIIRN 539 LG+G F V D + +VA+K+I+N Sbjct: 737 LGEGTFGKVLECYDKKTGDVVAVKVIKN 764 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 7 VSNSCSPGDPLVL 19 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 61 AGDFSLVXNSCSPGDPLVL 5 AG NSCSPGDPLVL Sbjct: 18 AGSLRSRSNSCSPGDPLVL 36 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 10 VSNSCSPGDPLVL 22 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 S NSCSPGDPLVL Sbjct: 12 SFTSNSCSPGDPLVL 26 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 49 SLVXNSCSPGDPLVL 5 +++ NSCSPGDPLVL Sbjct: 12 NILSNSCSPGDPLVL 26 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 2 VSNSCSPGDPLVL 14 >SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 420 ELINKKYTIKDTLGQGVFANVARAQDNQENXIVAIKIIR 536 + I K YTIKD LG+G F V + + + A K I+ Sbjct: 152 DAITKYYTIKDELGKGRFGVVCKCVNKKTGKQFAAKFIK 190 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 40 PDIEFLQPGGSTSSR 54 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 50 FPRXEFLQPGGSTSSR 3 F + EFLQPGGSTSSR Sbjct: 27 FCKIEFLQPGGSTSSR 42 >SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) Length = 213 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 139 RIEFLQPGGSTSSR 152 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 I+ + NSCSPGDPLVL Sbjct: 9 ISANIGKTSNSCSPGDPLVL 28 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 65 YCWRFFPRXEFLQPGGSTSSR 3 Y W+ + EFLQPGGSTSSR Sbjct: 21 YTWQ---KIEFLQPGGSTSSR 38 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 40 VSNSCSPGDPLVL 52 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 184 VSNSCSPGDPLVL 196 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 34 VSNSCSPGDPLVL 46 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 1066 VSNSCSPGDPLVL 1078 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 76 SILDIAGDFSLVXNSCSPGDPLVL 5 +I D+ + NSCSPGDPLVL Sbjct: 79 NIWDLLRPCIVTSNSCSPGDPLVL 102 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 16 RIEFLQPGGSTSSR 29 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 ++ NSCSPGDPLVL Sbjct: 14 VISNSCSPGDPLVL 27 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L NSCSPGDPLVL Sbjct: 78 LTSNSCSPGDPLVL 91 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 64 IAGDFSLVXNSCSPGDPLVL 5 I+ + + NSCSPGDPLVL Sbjct: 9 ISANIVHISNSCSPGDPLVL 28 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 3 VSNSCSPGDPLVL 15 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 214 VSNSCSPGDPLVL 226 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 228 RIEFLQPGGSTSSR 241 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 32 VSNSCSPGDPLVL 44 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 12 PPIEFLQPGGSTSSR 26 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 46 LVXNSCSPGDPLVL 5 L NSCSPGDPLVL Sbjct: 5 LASNSCSPGDPLVL 18 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 402 YRINIGELINKKYTIKDTLGQGVFANVARAQDNQENXIVAIKII 533 Y+ + K+Y IK +G+G F+ V R + Q AIK++ Sbjct: 60 YKARFDIRVTKEYEIKALIGRGSFSRVVRVEHYQTKQPYAIKMM 103 >SB_58201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 72 FLILLEIFPSXRIPAARGIH 13 F L +I P RIPAARGIH Sbjct: 48 FFHLTQILPGDRIPAARGIH 67 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 5 VSNSCSPGDPLVL 17 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 3 VSNSCSPGDPLVL 15 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 55 DFSLVXNSCSPGDPLVL 5 D + NSCSPGDPLVL Sbjct: 183 DLVIQSNSCSPGDPLVL 199 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 2 RIEFLQPGGSTSSR 15 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 7 VSNSCSPGDPLVL 19 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 7 PYIEFLQPGGSTSSR 21 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 64 RIEFLQPGGSTSSR 77 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 4 VSNSCSPGDPLVL 16 >SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) Length = 91 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 47 PRXEFLQPGGSTSSR 3 P EFLQPGGSTSSR Sbjct: 2 PYIEFLQPGGSTSSR 16 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 4 VSNSCSPGDPLVL 16 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 43 VXNSCSPGDPLVL 5 V NSCSPGDPLVL Sbjct: 11 VSNSCSPGDPLVL 23 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RXEFLQPGGSTSSR 3 R EFLQPGGSTSSR Sbjct: 10 RIEFLQPGGSTSSR 23 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 73 ILDIAGDF-SLVXNSCSPGDPLVL 5 I+ + G F L NSCSPGDPLVL Sbjct: 56 IIFMEGRFPKLSSNSCSPGDPLVL 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,893,444 Number of Sequences: 59808 Number of extensions: 426425 Number of successful extensions: 2531 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2521 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4918128563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -