Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_D06_e620_08.seq
         (1502 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g01160.1 68416.m00020 expressed protein                             29   7.9  

>At3g01160.1 68416.m00020 expressed protein
          Length = 380

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 15/56 (26%), Positives = 31/56 (55%)
 Frame = +1

Query: 145 NKAHDFKSSAERIXNESQDLTIELKEFLSNTSSTPADVRTLANDILNLSIRIEPKE 312
           ++ H  K+  ++  N  Q   +E+KEFL++  S   +   L N+++N S + + K+
Sbjct: 40  DEPHRIKTLNQKF-NPEQLANLEMKEFLASDESDSDEEDDLGNEVINQSKKKDKKK 94


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,459,669
Number of Sequences: 28952
Number of extensions: 85579
Number of successful extensions: 217
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 211
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 217
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4009654272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)