BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D03_e596_07.seq (1559 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0218 - 1717246-1717892,1717995-1718163,1718262-1720022,172... 31 3.3 08_01_1022 + 10323158-10323393,10323486-10323531,10325887-103259... 29 10.0 >03_01_0218 - 1717246-1717892,1717995-1718163,1718262-1720022, 1720531-1720610,1720854-1720981,1721004-1721012, 1723701-1723742,1725891-1726002,1726358-1726514, 1726678-1726762,1727628-1727713,1727998-1728042 Length = 1106 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -2 Query: 481 APCPPPRRSGGTLATAPSWLFCAGTIRNSHVRTAPAQANTCTS 353 +P P GTL TAPS L G ++ + P+ A+ C+S Sbjct: 809 SPFPDDLPPIGTLVTAPSVLIHPGVLQENSTEVPPSPASWCSS 851 >08_01_1022 + 10323158-10323393,10323486-10323531,10325887-10325941, 10326027-10326107,10326189-10326400 Length = 209 Score = 29.1 bits (62), Expect = 10.0 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 366 LACAGAVRTWLFRMVPAQNSQEGAVAKVPPLRR 464 LA A +V L MV A A+A++PPLRR Sbjct: 25 LAAAESVGDHLAEMVAAAGEDPDAIAELPPLRR 57 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,327,957 Number of Sequences: 37544 Number of extensions: 429139 Number of successful extensions: 1303 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1303 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5035314872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -