BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D02_e588_08.seq (1425 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21286| Best HMM Match : DUF352 (HMM E-Value=0.47) 29 9.0 SB_49331| Best HMM Match : DUF352 (HMM E-Value=0.47) 29 9.0 >SB_21286| Best HMM Match : DUF352 (HMM E-Value=0.47) Length = 690 Score = 29.1 bits (62), Expect = 9.0 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -2 Query: 557 SIEKQWEIG---VWQFIKICQLIDGINYLIYKSAVRSGISHSPT 435 S E WE+ V I +C D INY Y SA S +SH T Sbjct: 499 SREGNWELHLSCVRDMISLCFAYDNINYARYLSAYLSEMSHLDT 542 >SB_49331| Best HMM Match : DUF352 (HMM E-Value=0.47) Length = 586 Score = 29.1 bits (62), Expect = 9.0 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -2 Query: 557 SIEKQWEIG---VWQFIKICQLIDGINYLIYKSAVRSGISHSPT 435 S E WE+ V I +C D INY Y SA S +SH T Sbjct: 499 SREGNWELHLSCVRDMISLCFAYDNINYARYLSAYLSEMSHLDT 542 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,168,478 Number of Sequences: 59808 Number of extensions: 546385 Number of successful extensions: 2383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2382 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4565995253 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -