BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_D01_e580_07.seq (1550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) 32 1.4 >SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) Length = 711 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = -3 Query: 270 GRRSSTNSATKS*TLASPQSMVYYEGLQLPRIVYLEGTEVSK*STEAMLKCRSLXLYS 97 GRR+ N S TL Q Y+EG ++ R Y T +++ + +L+ R+ Y+ Sbjct: 445 GRRAYDNYTNMSRTLPEGQGQCYFEGKEISRSSYEHVTNLARGARPVLLRRRAYDNYT 502 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,165,068 Number of Sequences: 59808 Number of extensions: 599094 Number of successful extensions: 1013 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5058981887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -