BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_C12_e667_06.seq (1513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_26663| Best HMM Match : Telo_bind (HMM E-Value=1.8e-17) 29 7.4 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 1 SWXXPAVAAALXTSGXPPGCRXFGTRVQC 87 +W AVAAAL PPGCR + VQC Sbjct: 3 NWSSTAVAAALELVD-PPGCRNSISLVQC 30 >SB_26663| Best HMM Match : Telo_bind (HMM E-Value=1.8e-17) Length = 1086 Score = 29.5 bits (63), Expect = 7.4 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 323 LRTASASVPS*NGPNHHRV*QMSNQSTDARLHRTRPHDSQSRCDN 189 L +A VPS P+ + SN + AR R RPHD S D+ Sbjct: 168 LYSAQGRVPSEKEPSKAQKVAKSNPTQPARSLRKRPHDCDSTTDS 212 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,380,333 Number of Sequences: 59808 Number of extensions: 590491 Number of successful extensions: 1128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4906390786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -