BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_C12_e667_06.seq (1513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 26 2.5 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 25 7.6 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 25 7.6 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 25 7.6 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 26.2 bits (55), Expect = 2.5 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = -1 Query: 439 VILRMEIIGPLGGTQNDMYARLSFNQLAQLTNLQCKSDVFERLLHLSLLETAQITIAFS 263 V+LR E I LG +DM +R S QL +T+ + +F+ L ++ ITI S Sbjct: 198 VLLRHENI--LGYVGSDMTSRNSCTQLWLITHYYPQGSLFDYLNRTAISTHQMITICLS 254 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 148 IFFIRDPVLFPSFIHTQKRN 167 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 575 IFFIRNHYLFMNFVFFFKRN 634 IFFIR+ LF +F+ KRN Sbjct: 132 IFFIRDPVLFPSFIHTQKRN 151 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,128,180 Number of Sequences: 2352 Number of extensions: 20037 Number of successful extensions: 57 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177188220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -