Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_C08_e635_06.seq
         (1535 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB252421-1|BAE80739.1|  122|Apis mellifera GB15078 protein.            25   1.3  

>AB252421-1|BAE80739.1|  122|Apis mellifera GB15078 protein.
          Length = 122

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 16/66 (24%), Positives = 24/66 (36%), Gaps = 2/66 (3%)
 Frame = +2

Query: 146 PITLRHA*PCAPSTQRRM--AHYCQAKHDGCQSEIGRAVALFCFTAPFNHLFYFWLMSIM 319
           PI + H  P + +       A   +A H      +GR +  FC    F      WL   +
Sbjct: 2   PILIPHRNPASANYYENKDGARIVKASHFELDYMLGRKITFFCMATGFPRPEITWLKDGI 61

Query: 320 SKYAYK 337
             Y +K
Sbjct: 62  ELYHHK 67


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 317,981
Number of Sequences: 438
Number of extensions: 6383
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 61
effective length of database: 119,625
effective search space used: 53831250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)