BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030731E7_C08_e635_06.seq
(1535 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 25 1.3
>AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein.
Length = 122
Score = 25.4 bits (53), Expect = 1.3
Identities = 16/66 (24%), Positives = 24/66 (36%), Gaps = 2/66 (3%)
Frame = +2
Query: 146 PITLRHA*PCAPSTQRRM--AHYCQAKHDGCQSEIGRAVALFCFTAPFNHLFYFWLMSIM 319
PI + H P + + A +A H +GR + FC F WL +
Sbjct: 2 PILIPHRNPASANYYENKDGARIVKASHFELDYMLGRKITFFCMATGFPRPEITWLKDGI 61
Query: 320 SKYAYK 337
Y +K
Sbjct: 62 ELYHHK 67
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 317,981
Number of Sequences: 438
Number of extensions: 6383
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 61
effective length of database: 119,625
effective search space used: 53831250
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -